KEGG   Seriola dumerili (greater amberjack): 111217447Help
Entry
111217447         CDS       T05606                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7-like isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
sdu  Seriola dumerili (greater amberjack)
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sdu04131]
    111217447
Membrane trafficking [BR:sdu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    111217447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N TEA
Motif
Other DBs
NCBI-GeneID: 111217447
NCBI-ProteinID: XP_022595038
Position
Unknown
AA seq 2125 aa AA seqDB search
MTSTASERRAFAHKINRTVAAEVRKQVSREYGSPQLSKKRGGAHQPLPLTEVVEPVDFEE
YVSSHAPAVEPGPLRQLMEFPQDDLELLQLDKECTTLEPPLPEEEDSLDPRVRDALAVYT
DDWLVIQRKYQRYSTTYTPQNSERQRERQRGLVKQTFELDAAAAAERQDDQDDAKRRSVS
LDETPRGSWASSIFDLKNSSPDALLPSVLERTAAEDMDRRNTEARLQGRHSDLLGLYPPP
DEDEAVERCSVPEVPKEHCGQRIMVKCLSLKFEIEIEPIFGTLALYDVKEKKKISENFYF
DLNSDQMKGLLKPHTPHIAISTLARSAIFSITYPSADIFLVIKLEKVLQQGDIGECCEPY
MVMKESDSSKHKEKLEKLRLQAEQSCSRLGQFRMPFAWTAIHLLNIVSSVGGLDRSDPDS
DSERKSHGTWNERKKKGFERMSVGDDMCNFATFRPATLTVTNFFKQEGDRLSDEDLYKFL
ADMRRPSSVLRRLRPVTAQLKIDISPAPDLPHYCLSPELLHVKPYPDLRVRPTKEVQEFP
ARYVYTPHTTYRNLLYVYPQTLNFSSRQGSVRNIAVKVQFMAGEDPSQALPVIFGKSSCA
EFMKEAYTPVIYHNKSPEFYEEMKMKIPANLTDNHHLLFTFYHISCQPKQNTPLETPVGY
TWIPLMQHGRLRTGSFSLPVSVEKPPPSYSVLTPDVQLPGMKWVDNHKGVFNVEVTAASS
VHTQDPHLDKFFTLVYVLEEYSFPFRLKDVIITEANMEGELKASIAALRGSLLDTCVRFL
HQLLNKLIQLIVYPPVIAGQIVNLGRAAFEAMALLVNQMHKNLEGNQDQHGRNNLLASYI
HYCFHLPTAEPVMPPTGAGTQSYEMPMQYATLSRATARPSSLHLSRSKSISNSNPDLAST
PVSPDEEVQRIIGSKGIDRSHSWVNSAYAPGGSRSVLRRNPNSSCELKQLLHEELALQWV
VSTSTVREAALQQAWFFFQLMTKSMANHLFLTSKLDIARRQRFPDRFVDDIAAHVCAISA
DIANRYHKDVELVERLNNSLAFFLNDLLSLMDRGFVFNLMRSYYKQIASKLHTAQNPSSL
NALRMDFTRIVCSHEHYVILNLPCSTLSPPASPSPSTSSTTSQSSAFSSMVQDQGVATMF
ELSVPFRHQHFLSGLLLTELSLILDPDGEGVFFLHKKAISAVHSLLCSHDADPRYSDPQV
RAHIAQLYLPLIPIVMETLHQLHDFSDSSPARVRHASAHTDDADPDGSNTISQSVAMAIA
GSPLPHAKANAFALPTVAGRQSSSLSAECSRTLLVCFLWVLKNADAALLERWVSDLSVLQ
INRLLDLLHLCVSCFEYKGKKALERINSLTFKKSQDMKARLEEAILGTIGARQEMVRRCR
GALHESTLVCVCSCFCLRCLFGCAHGNYNLFTLPERSPYGSQENVRWRKNVTHWRQNTDR
VDKTKAEVEQESVVDGNLATEASLIVLDTLEIVVKTVVASELKESVLGGVLRVLLHSMAG
NQSALFLQHCFTTQRALVFKFPEMLFEEDTELCADLCLRLLRHCSSSVGSVRSHASASLY
LLMRQNFEIGNNFARVKMQVTMSLSSLVGTSQNFNEEHLRRSLKTILTYAEEDLELRDTP
FPEQVQDLVFNLHMILTDTVKMKEHQQDPEMLIDLMYRIAKGYQNSPDLRLTWLQNMAGK
HSERGNHAEAAHCLVHSAALVAEYLNMLEDCRYLPIGCVTFQHISSNVLEESAVSDDVLS
PEEEGICAGKYFSESGLVGLLEQAAASFNMAAMYEAINEVYKILLPIHEANRDFKKLATV
HGKLHDAFNKVYNQSSGWERMFGTYFRVGFYGCRFGDLDEQEFVYKEPSITKLAEISHRL
EEFYSERFGDEVVEIIKDSNPVDKTKLDANKAYLQITYVEPYFDTYELKERITYFDKNYN
LRTFMYCTPFTLDGRAHGDLHEQYKRKTILTTSHAFPYIKTRINVIHKEEIILVPMEVAI
EDMQKKTQELAFATNQDPADSKMLQMVLQGCVGTTVNQGPLEVAQVFLSDIPNDPKLFRH
HNKLRLCFKDFNKRCEDALRKNKALIGPDQKEYHRELERNYNKLKEALGPLINRKIPQLY
RTLPAQTTQTQRNSYSRSSLRRVDC
NT seq 6378 nt NT seq  +upstreamnt  +downstreamnt
atgacatctacagccagcgaaaggagggcgttcgctcataaaatcaaccgaacggttgct
gccgaggtcagaaaacaagtgtccagagagtatggctctcctcagctgtcaaagaagcga
ggcggtgcacaccaacccttgcccctgacagaggtggttgagccggtggattttgaggag
tatgtgagcagtcacgctccagccgtggagcctggcccactcagacagctaatggagttc
ccccaggatgacctggagctcctccagctggacaaagagtgcactacactggagccccca
ctgccagaggaggaggactcattggatcccagagtgagagatgccttggcagtctacaca
gacgactggcttgtcattcagagaaagtatcagcgctacagcaccacatacacccctcag
aactctgagcgacagagggagaggcagcgaggcctggtcaaacagacctttgaactggac
gccgctgccgccgccgagcgtcaggatgaccaggatgacgcaaagcggcggtcagttagc
cttgatgagacccctcggggcagctgggcctccagcatcttcgacctgaagaactcctcc
ccagacgctctcctgccgtccgtgctggaacgtacagctgccgaggacatggaccgccgc
aatacggaggcacgcctgcaggggcgccacagtgacctgctgggcctgtaccctccccct
gatgaggatgaagccgtagagagatgctctgttcctgaagtgcccaaagaacattgtggc
cagaggatcatggtcaagtgtctgtctctgaaatttgaaatagaaattgagccaatattt
ggaacacttgccctctatgatgtcaaggaaaagaagaagatctctgagaatttttacttt
gacctgaactcggatcagatgaaagggctgctaaaaccccacacacctcacatagccata
tccacactggcccggtctgccattttctccatcacatacccttccgccgatatcttctta
gtcattaagcttgagaaagtccttcaacaaggagacattggagaatgctgtgaaccctac
atggtcatgaaagagtcagattcctctaagcacaaggagaagctggagaagctgcgtctg
caggcagagcagtcatgcagtcgtcttggtcagtttcgcatgccttttgcctggacagcc
attcaccttctcaacattgtcagcagtgtaggaggtctggatcggtcagacccggactct
gactctgagcgaaaaagtcatgggacatggaatgagagaaagaagaaggggtttgagcgg
atgagcgttggggacgacatgtgtaactttgccactttccgacctgcaacgctcactgtc
actaacttcttcaaacaggagggggacagactaagtgatgaggacctctacaagtttctg
gcagatatgcgccgaccatcatctgttctgcggagactgagacccgtcacagcccagttg
aagatcgatatctctccagctccggacctgcctcattactgtctgtcaccggagctgctc
cacgtgaagccttaccctgacctgcgtgttcgcccaaccaaagaggtgcaggagttccct
gctcgctatgtgtacactccacacaccacctacaggaatctgctatacgtttacccacaa
actctgaacttcagcagtcgccagggctcggtgagaaacattgctgtgaaagttcagttc
atggcaggagaggaccccagtcaagctttgccggtcatctttggaaagtcgagctgtgct
gagttcatgaaagaggcgtacacccctgtcatctaccataacaagtctcctgagttctac
gaggagatgaagatgaagattcctgccaatctgacagataaccaccatctgctgttcacc
ttctaccacatcagctgccagcccaaacagaacactcctctggagacccctgtgggctac
acttggatccctctgatgcagcatggccgactacgcactggctccttcagtctgcctgtc
tcggtggaaaagcccccgcctagctactctgtactcacccctgacgttcagctcccaggc
atgaagtgggtggataatcacaaaggagtgttcaatgtcgaggtgacagcagcttcctcg
gttcacactcaggacccccacctggataagttcttcactctcgtgtatgttctggaggag
tactctttccccttccgcctgaaggacgtcatcataaccgaggcaaacatggagggggag
ctgaaggccagcatagctgcactgagagggtctctgctggacacctgtgtcaggtttttg
caccagctgctcaataagctcattcagctcatcgtctacccaccggtcattgcgggtcaa
attgtgaacctgggccgtgctgccttcgaagctatggcattgttggtcaaccagatgcac
aagaacctggaggggaaccaggatcagcacggccgcaacaacctgttggcatcctacatc
cactactgcttccacctgcccaccgccgaacctgtaatgcccccgacaggagcgggcact
cagtcttacgagatgcctatgcagtacgccaccttatcgagagcaaccgcccgcccaagc
agcctgcacctatcccgctccaagagtatcagcaactccaaccctgacctggccagcaca
ccggtttctcctgacgaagaggtgcaaaggatcatagggagcaagggcattgaccgctcc
cactcctgggtaaactctgcttatgcccctgggggctccagatctgtgctacgccggaac
cccaactccagctgtgagctcaagcagctactccatgaggagctggcattacagtgggtg
gtcagcaccagcacagtgagggaagcagcgctgcagcaggcctggtttttcttccagctt
atgacaaagagcatggccaatcacttattcctgacctcgaaattagacattgccaggcgt
cagcgtttcccagaccgctttgtggacgacattgctgcacatgtgtgcgccatcagtgca
gacattgccaaccgataccacaaggatgtggagcttgtggagaggttaaacaacagtctg
gccttcttcctgaatgacctgctgtctctcatggaccggggctttgtgttcaacctaatg
cgctcctactacaaacagattgccagcaagctccacactgcgcagaaccccagctctctg
aatgcactgaggatggacttcactcgtatcgtctgcagccacgagcactatgtcatcctc
aacctgccgtgctcaaccctcagccctccagcctccccctccccctcgacatcctccacc
acttcacagagttcagcgttttccagtatggtgcaagaccaaggtgtggccaccatgttt
gagctctccgtcccttttcgccaccagcacttcctgtctggtctgctgcttaccgagctc
tctctcattcttgatcctgatggagaaggggttttcttccttcataaaaaggccattagt
gctgttcactccctgctctgcagccatgatgcagacccccgctacagtgaccctcaggtc
agagcccacattgctcagctctacctgcccctcatccccattgtcatggagacactgcat
cagcttcacgacttctctgactcctcgcctgcgcgggtccgccatgcctcagcccacacc
gatgacgctgacccagacggtagcaacactatcagtcagtctgttgccatggcgattgcc
ggctcccctctgccgcatgccaaagccaacgcatttgcactacccacagtggctgggcgg
cagtccagctctctgtccgctgagtgcagcaggactctgctggtgtgtttcctgtgggtg
ctgaagaatgcagatgcagctctcctggagcgctgggtgtctgatttgtctgtgttgcaa
atcaaccgcctgctggatctgctgcatctctgtgtctcctgctttgaatacaaggggaag
aaggctctggagaggatcaacagcttaacgtttaaaaagtctcaggacatgaaggcccga
ctggaggaggccatactgggcaccattggggctcgtcaggagatggttcgccgctgtagg
ggtgcgttgcatgagagcacattagtgtgtgtgtgtagctgtttttgtttgaggtgtttg
tttggctgtgctcatggaaactataatttgtttactcttccagaaaggagtccctatggc
agccaagagaacgttaggtggagaaagaacgtcactcactggagacaaaacacagacaga
gtggataagactaaagctgaggtggagcaggagtctgtggtggatggaaacctagctact
gaggcctctctgatagtactagacacactggagattgtagtcaagactgtggtggcgtca
gagctgaaggaaagtgttctaggcggggtactgagagtgctgctccacagcatggcaggc
aaccagagtgccctcttcctgcagcactgcttcactacacagagggctctggttttcaag
ttcccagagatgctgtttgaagaggacactgagctttgtgcagacctgtgcctccgtctc
cttcgtcactgcagcagtagtgtcggctctgtcagaagtcatgcctccgcctctctttac
ctgctcatgaggcagaactttgagattggaaacaactttgcacgagtgaagatgcaggtc
accatgtctctgtcctcgctggtgggaacgtcgcagaacttcaacgaagagcatcttcgt
cggtcgctcaagacgatcctaacatatgctgaagaggacttggagctgcgtgacacgccc
ttcccggagcaggtccaggatctggtgttcaacctgcacatgattcttactgacactgtg
aagatgaaagagcatcagcaggatccagagatgctcattgacttaatgtacaggattgcc
aagggctaccagaactcaccagacctgcgtcttacgtggctccagaacatggcgggaaaa
cactctgagagagggaaccatgccgaagctgcccactgtctggtccacagcgccgcactg
gtggcagaatacctcaacatgctggaggattgccgctacctgccaattggttgtgtcact
tttcagcacatttcatccaatgtattggaggagtcagcagtatctgatgacgtcctgtct
ccagaggaggaggggatttgtgctgggaagtacttcagcgagtctggcctggtgggcctc
ctggagcaagcagctgcgtcttttaacatggcagccatgtacgaggccataaacgaagtg
tacaagattctactgcccatccatgaagccaacagagacttcaaaaagctggctactgtt
cacgggaaactgcacgacgccttcaacaaagtctacaaccaaagttcaggatgggagaga
atgtttgggacttacttccgggtcggtttctatggctgccgatttggagacctggatgaa
caagagttcgtctacaaggagccgtcaatcaccaaattagccgagatttcccacagactt
gaggagttctactcagagaggtttggggatgaggtggttgaaatcatcaaggactccaac
ccagtggacaaaaccaaactggatgccaacaaggcctacctccagatcacctatgtcgag
ccgtactttgatacatacgagctaaaggaaaggatcacctactttgacaagaactacaac
ctgcgtaccttcatgtactgcactcccttcacgctggacggccgagcccacggcgacctg
cacgagcagtacaaacgcaaaaccattctgacaacatctcatgccttcccttacatcaag
acgcgtatcaacgttatccacaaggaggagatcattcttgtccccatggaggtggccatt
gaggacatgcagaagaagactcaggagctcgccttcgccacaaaccaagaccctgcggac
tctaagatgctgcagatggtgctgcagggctgtgtgggcaccactgtcaaccagggcccc
cttgaggtggcgcaggtctttctttccgacatccctaatgacccaaagctgtttcgccat
cacaacaaactgcgcctctgctttaaagacttcaataagaggtgtgaggatgccctgagg
aagaataaagccctgattggaccagatcagaaggagtaccacagagagctggagaggaac
tacaacaagctgaaagaagctctgggtcctctcatcaaccgcaagatccctcagctatac
agaaccctgccagctcagactacgcaaacacaacggaactcctacagtaggtccagtctc
cgcagagttgactgttga

DBGET integrated database retrieval system