KEGG   Seriola dumerili (greater amberjack): 111217841Help
Entry
111217841         CDS       T05606                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6-like
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04010  MAPK signaling pathway
sdu04060  Cytokine-cytokine receptor interaction
sdu04068  FoxO signaling pathway
sdu04210  Apoptosis
sdu04217  Necroptosis
sdu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111217841
   04068 FoxO signaling pathway
    111217841
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111217841
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111217841
   04217 Necroptosis
    111217841
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111217841
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sdu04147]
    111217841
   04052 Cytokines and growth factors [BR:sdu04052]
    111217841
   04090 CD molecules [BR:sdu04090]
    111217841
Exosome [BR:sdu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   111217841
Cytokines and growth factors [BR:sdu04052]
 Cytokines
  Tumor necrosis fators
   111217841
CD molecules [BR:sdu04090]
 Proteins
  111217841
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 111217841
NCBI-ProteinID: XP_022595552
Position
Unknown
AA seq 228 aa AA seqDB search
MSPVEVTEEEKFLSVHVVESRPGLGQWQWRVGGAQTLLFLMVSVALCGMVIEACFIYRLY
RAESATTASSSKLFAGQEVASFTEKLGHDVPPSKPVAHLTDGTDVVHGQQIMAWSMITDP
LLYGMSYKDRRLIIQKEGYYYVYSKVFFLDKGVFHHSVSMETQKYTGGSLTLLQSRKYSP
ETHQSRSNSYLGGVFRLNKDDALYVTVSNTTKIEQHGWSENIFGAFMI
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgagccctgtagaagtgactgaggaggagaagtttctctctgtgcatgtggtggagagc
cgacccgggctgggccagtggcagtggcgtgtggggggggcgcagaccctgctgttcctg
atggtgagcgtggcgttgtgtggcatggtcatagaagcctgcttcatctaccgtctctac
cgagctgaatctgccaccacagcgtcgtcctctaagctctttgcaggtcaggaagttgca
tctttcactgaaaagcttggtcatgatgttcctccttccaaaccagttgcacatctgaca
gatggaacagatgtagttcatggacagcagatcatggcgtggagcatgatcacagaccct
ctcctctatggaatgagctacaaagacagacgtcttatcattcagaaggagggttattat
tatgtctattcaaaggttttcttcttagacaaaggtgtatttcaccattctgtcagtatg
gagactcaaaagtatactgggggaagtctgaccctcctgcagtccaggaaatactcccca
gagacacatcagtctcgatccaacagttacctgggtggagtgtttcgcctgaacaaagat
gatgctctttatgtgacagtcagcaacaccacaaaaattgagcaacacggatggtctgag
aacatctttggtgcatttatgatataa

DBGET integrated database retrieval system