KEGG   Seriola dumerili (greater amberjack): 111218023Help
Entry
111218023         CDS       T05606                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111218023
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sdu04030]
    111218023
G protein-coupled receptors [BR:sdu04030]
 Rhodopsin family
  Lipid
   Leukotriene
    111218023
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 111218023
NCBI-ProteinID: XP_022595833
Position
Unknown
AA seq 342 aa AA seqDB search
MNNSADPSFSKEMAPEEFDGATAVACVILGLSFLIGAPGNVLVIWTILRHVKQRSHTVVL
ILHLAAADLLVLITLPLWIYSLVHTWVFGWASCIALVYIISVCMFSSIFFITLMSVERFV
AICHPFVMKRWKTKSVMNKCLILLWLLAILLGVPVLLTQPLDEDSGTEQCFMKEFSSVTQ
AIIFLCLETFGGFVVPFIILSTCYCLVAAQLQKMSYNTKQKSMVLVNAVVIAFTLCWLPY
HIINIIDLVCILESGREHECVPKSIVFTSGALVFISSSVNPVLYAFFARNIRGSLEESRL
TRLFQEMAAHTNKLRELVVQQQTGQRAACTQVELMSDLCEKN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaacaactcagctgacccgtctttttcaaaggaaatggcccctgaggagtttgatggt
gcgacagcagtggcttgtgtgatcctgggtctgtcctttctgataggagctccgggaaac
gttctggtgatctggaccatcctgagacacgtcaagcagcgttcccacactgtggtgctt
atcctgcacctggctgctgcagacctgctggtcctcatcaccctgcctctgtggatctac
tctctggtacacacctgggtgttcggatgggcctcctgtatagccttggtgtacattatc
agtgtgtgcatgtttagcagcatcttcttcatcacccttatgagtgtggagcgctttgta
gccatctgccatccatttgtgatgaagcgctggaagaccaagagtgttatgaacaaatgt
ctcatacttttgtggctacttgctatccttctgggagtacctgttttattaactcagcct
ttggatgaagatagtggaactgagcagtgttttatgaaggaattcagctctgtgactcaa
gcgatcatcttcttatgcctggagacctttgggggctttgtggttcctttcattatcctt
agtacatgttactgtctagtagctgcccagctccagaaaatgagttacaacaccaaacag
aaatccatggttcttgtcaatgcagtggtaatagcctttactctgtgctggttgccttac
catattatcaacattattgatctggtttgcatcttagaatcaggtagagaacatgaatgt
gtgccaaagagtattgtctttacctctggtgcccttgtattcattagcagttcagtgaat
cctgtgttatatgccttcttcgcaaggaacattcgaggcagtctggaggagtcccgactc
accagactgttccaggaaatggccgctcataccaacaaactcagggagctggtagtacaa
cagcagacaggccagagggcagcatgtacacaagtagaactaatgtcagatctgtgtgag
aaaaactga

DBGET integrated database retrieval system