KEGG   Seriola dumerili (greater amberjack): 111218584
Entry
111218584         CDS       T05606                                 

Gene name
aff3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
sdu  Seriola dumerili (greater amberjack)
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sdu03021]
    111218584 (aff3)
Transcription machinery [BR:sdu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     111218584 (aff3)
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int
Other DBs
NCBI-GeneID: 111218584
NCBI-ProteinID: XP_022596674
Position
Unknown
AA seq 1245 aa
MPTVLGGKGKLSIVCFLLRCAYSQVTRSQHNSCAKDILEDMTQSWPSQQALGGDQAQRIL
YSPKDAKQPTTQQRQSRGDVQQRMTRHPHVAPHKSMLADDLKLSSDDDDTQRAIHESASW
DRHSLSAQRVHTHGRRVRHSSSDSSGSDSSAESGSSSLRSRSPSPDVHPDPASPANTQPL
CSNKEVPKLSHTNDHPSAAQWQLDKWLKKSRKKSASSEQDPSHSATGHLSSPHTQRAPSP
ARSWDSNQEYSPSQSPIPSPQFNYSHNNSPLPSPGYSYCPSPSPFPSTCPSPSPSPRYSP
IPSPVLSVCPSPFGSPGGSCSPSPVPRDPPRSPSPSLSPPSRVCHDPGVQSQNQTQPSLT
TNSHRKKIRSRIPRLPSIDTKNKPTNSSHPPPTHQHKPRTQPSQDRDQSQSKSKATAVLN
SNQSHNHKSRPKSNFHLNSKQLSEAPKAKHALNFEQIQGSRSHHRSNHKPRPPFQPSSQH
SPTRAKHLVPASRETNAHSTHSQSTSKAATNSGSGLNSRASPSLKPRARLWEATASTPVN
VNHTKSQKKTQNKEQQVDDRGDHLIQAEGRKHERKEDRHREKQQGKQERKEDKRLAEEQL
LRRPWIQSSAEEEEEEEEEGVLERQRRREETAKGENRRRREQQHRREWQTVQTKQRVSTN
TKRHRLHEDSHHQGRTKKGGKSEEERELQPDPSPSPSHSPTPHRPSSSCSSSSSSSTNSD
SESEHQAPITKVPADSTSHKRLARRGQQGPGRPDASRPKVVHSRGPISANPSEGQQSEGK
QKLYTLVPFGRSDQATVSSQRGLRNLVVKIDLCLLKRVPDSTTTSTVKKPFSSPSSSSST
KDKQREAMKHLYTPDTGTKDSKRKRKLENGESHRESKRSLPHASDLSGRTESSANTAECN
IVTETTHNGYLEEYLDSKRPLSPLSPLSNSPESTKPPSKTNTSEQHQIHTNKNRDKNRDS
AVKPKMEVECVKVSRQPQPLCESWGLTGHRGTVPNHDTPHHAEYYLHEAKRMKHRADAMV
DKLGKAVNYVDAALSFMECGKAMEEGPLEAKSPYTMYSETVELIRYAMRLKSHSGPGARQ
EDKQLAVLCFRCLALLYWQMFRLKKDHALKYSKVLLDYFKSSPKVPTTPPCWNDSGKGAG
GPPSSLSPNAKHLGRGSHGGSTSPSLISIPQRIHQMAANHLNITNSVLYSYEYWEVADNL
AKENKEFFNYLNTLSGPLTLHSSIAHTVQYTRQALQWIRISAKLN
NT seq 3738 nt   +upstreamnt  +downstreamnt
atgcctactgtcctcggtggcaaaggaaaactttccattgtctgttttctgctccgatgc
gcatattctcaggtaacaagaagccaacataacagttgtgccaaagatattctggaggac
atgactcagtcctggccgtcccagcaagccttagggggtgaccaggcccaacgaatcctc
tacagccctaaggatgcaaaacaaccaaccacacaacaaaggcaaagtcggggggatgtt
cagcagcgaatgacccgtcaccctcacgtggcaccgcacaaatccatgcttgctgatgac
ctgaagctgagcagtgatgatgatgacactcaaagggccattcatgagtcagcttcctgg
gatagacacagcctgtcagcacagcgagtgcacacacatggcaggcgggtgagacattcc
agctcggactcttcaggctcagactcctctgccgagtcaggcagcagtagccttcgttcc
cggagcccgagcccagacgttcacccggatcccgcatcgccagccaacacacagccactg
tgcagcaacaaggaggtaccgaagctgagccacacaaatgatcatccctctgctgcccag
tggcagttagataaatggctgaagaagtcccgcaaaaaatctgccagcagtgaacaagat
ccttcccacagtgctacaggacacctgtcctctcctcacacccagcgagccccatctcca
gccagatcctgggacagcaatcaggaatacagccctagtcaaagccctattcccagccca
cagttcaattacagccacaacaatagccccctacctagccctggttacagctactgccct
agccccagcccattccccagcacctgtccaagtcccagccctagcccgaggtacagccca
atcccaagcccagttctaagtgtttgccccagtccatttgggagcccaggaggcagctgc
agcccaagccctgtccctagagaccctccaagaagtccaagtcccagcttatctcctcct
tcaagggtttgtcacgaccctggggttcagagtcagaaccaaacgcaacctagcctaacg
actaattcacacaggaaaaaaattaggtcaaggattccccggttgcctagcatcgacacc
aagaacaagcccacaaatagtagtcatcctccgccaactcatcagcacaagcccaggact
caaccctcacaggaccgagaccaaagccaaagcaaatccaaggccactgctgttttaaac
tctaaccagagtcacaaccacaaatctagacccaagtctaactttcatctgaattctaaa
cagctctcagaggctcccaaagccaaacacgcattaaattttgagcaaatccaagggagc
agatcccaccacaggtccaaccacaagcccaggcctccgtttcaacccagctcacaacat
agccccacaagagcaaagcacttagttcctgctagtcgtgaaaccaatgcccacagtact
cattcccaatctacctctaaagctgctactaattctggtagtgggttgaactctagggct
agtcctagcctaaaacctagggccaggttgtgggaggctacagcgtcaactcctgtgaat
gttaatcacacaaaatcacagaagaaaacccaaaataaggaacagcaggtggacgacaga
ggagatcatctgatccaagcagaggggagaaagcacgagagaaaagaggacagacatagg
gaaaaacagcaagggaaacaggaaagaaaggaagacaagaggctggcggaggagcagcta
ctgagacgtccctggatccagagttcagcggaagaagaggaggaggaagaggaggaggga
gtactagaaaggcagaggaggagagaggagacagcaaaaggggaaaacaggagaaggagg
gagcagcaacacagacgcgaatggcaaacagtccagaccaaacagagagtgtcaaccaac
accaagcgacaccgccttcacgaggactcacaccaccaagggaggacaaaaaagggaggg
aaaagtgaggaggagagagagttacagccagacccttcaccttcgccgtcacattcccca
actcctcataggccatcctcctcatgctcatcctcttcttcttcctccacaaattcagat
tctgaatctgaacatcaggctccgatcaccaaagttccagcagattctacctcccacaag
agactcgccaggagagggcaacaaggcccaggcagacctgacgccagcaggccgaaggtg
gtgcactccagaggacctatttcggctaatccaagtgaggggcagcagagtgaggggaag
caaaaactctacaccctagtcccttttgggcgaagtgaccaggctacagtgtcttctcag
cgagggcttagaaatctggtggtgaagatagacctctgccttctcaaaagggtccctgac
agcactactacttccactgttaaaaaacctttttcctctccctcgtcctcttcatcaacc
aaggacaaacaaagagaggctatgaaacacctgtatacaccggacaccgggacaaaagac
agcaaaaggaaacgcaagcttgagaatggcgagtcacacagagaaagcaagaggagtctt
cctcatgcaagtgatctctcaggtcgcacagagtcatcagctaacacagctgaatgcaac
attgtgactgagaccacacacaatgggtacttggaggagtatttagacagcaagaggcca
ctgtctcccctgtctccactgtccaacagccccgagtccaccaaacctccctccaaaaca
aacacctcagagcagcatcaaatccacaccaataagaacagagacaagaatagagattct
gctgtaaagcccaagatggaggtggaatgtgtaaaagtatcacgacagccccagcccttg
tgcgagtcctggggtcttacaggacacagggggaccgtgccgaaccatgacactccacac
catgctgagtactacttacatgaggctaaacggatgaagcaccgtgctgatgcaatggtg
gacaagctggggaaggctgtgaactacgttgacgctgctctctccttcatggaatgtggg
aaagcaatggaggaaggcccactcgaggcaaaatctccatataccatgtactcagagaca
gtggagcttataaggtacgcaatgaggctgaagagccactctggccctggggcaagacag
gaagacaaacagctggcggttctgtgtttccgatgccttgccctactttactggcagatg
tttcgcttaaagaaggaccatgcactgaaatactccaaagtgctgctggactattttaag
agttctcccaaagtgcctactacaccaccctgttggaatgactctgggaagggtgcagga
ggacccccgtcatcactctcacccaatgccaaacaccttggacggggttcacatgggggc
agcacctccccctctctcataagcattccccaacgtatccaccagatggcagcaaatcac
cttaacataactaacagtgtcttgtacagctatgagtactgggaggtggctgacaacctt
gcaaaggagaataaagagttcttcaattacttgaatactttgtctgggccactgactctt
cacagcagcatcgctcacacagtccaatacaccagacaggctcttcagtggatacgcatt
agtgccaaacttaactaa

DBGET integrated database retrieval system