KEGG   Seriola dumerili (greater amberjack): 111218684Help
Entry
111218684         CDS       T05606                                 

Gene name
acod1
Definition
(RefSeq) cis-aconitate decarboxylase
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    111218684 (acod1)
Enzymes [BR:sdu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     111218684 (acod1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD DUF4352
Motif
Other DBs
NCBI-GeneID: 111218684
NCBI-ProteinID: XP_022596819
Position
Unknown
AA seq 474 aa AA seqDB search
MIRKGITESFGAAIHALNTARLTDGVINRSKRMILDTLGVGLLGTRTAVFNKALTYSQLF
TSEERSSVWGKSDITLPPHYAAFVNGIAVHSMDFDDTWHPATHPSGAVLPALLALVETLP
SQTSGLDLLLAFNVGIEVQGRLMRFSREAYNIPERFHPPSVVGVMGSAAASAKLLGLSPA
QCSHALAIAASSAGAPLANAATQTKPLHIGNAARRGLEAAQLAQMGLEGNPAILDMDHGF
GVYYKDYCPSAVADSASGGFKWILEDQNVAIKRIPAHLGMHWVVDAALAARRQLENTVGN
FDLSHIQHITLRVPPSKYINCPLPSTEHQARHSFQFNACSALLDNKVTVASFSEAQINRP
ALKRLLAKVTVENPEDNPPSFDKMYCEVQIETDQGQTYTARCDTFYGHWRKPLSHKDLVE
KFSVNASSVLCTKGVEGVIDVMGNLERVSECSVLGSYLRMTSSPHRQLYSRKVF
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgatacgcaagggtattacagagagctttggagctgctatccatgccctcaacaccgct
cggctaacagatggtgtgattaacagaagcaaaaggatgattctggacaccctgggcgtt
gggttattaggaaccaggacagctgtcttcaacaaggctctcacgtacagccagttgttc
acatctgaggagaggagcagtgtttggggtaaatcagacataactctccctcctcactat
gctgcatttgtcaatggcatcgcggtccactccatggactttgacgacacatggcatcct
gctactcatccctcgggggctgtgcttcctgcactgctggccctggtagagacactgccc
agccagacctctggtctagacctgctgctggcctttaatgttggcatcgaggtgcaaggc
agactcatgaggttctccagagaggcatacaacatccctgagagattccaccctcccagt
gttgttggggtgatggggagtgctgcagcctcagccaagctgctgggtctttcccctgca
caatgcagtcacgctctggctatcgcagcctcctctgctggggctcccttggccaacgct
gccacacaaaccaaacctctccacataggaaatgctgctcggagaggcctggaagctgct
cagctagcccagatgggattggaggggaatccagccatcctggatatggaccatgggttt
ggggtttactacaaagactactgtccttcagcagttgcagattctgcctctggcggcttt
aaatggattctggaagatcagaatgtggccatcaagcgcatccctgctcatctggggatg
cactgggttgtggatgcagctctggcagcccgcagacagcttgaaaatacagttgggaac
ttcgacctcagccacatccagcacatcacactacgagtacctccatccaagtacattaac
tgccccttgccttccacagagcaccaggccagacactcatttcagttcaacgcctgctct
gctctgctggataacaaagtaacggtggcctccttcagcgaagctcaaattaaccgacct
gctctgaagaggcttctggctaaagtgacggtcgagaaccctgaagataacccacccagc
tttgacaagatgtactgtgaggtccagatagaaacagatcaggggcagacttacacagcc
aggtgtgataccttttatggccactggaggaagccactgagtcacaaggacctggtggag
aagttcagtgttaatgcatcttcggtgttgtgcacaaagggggtggagggagtgattgat
gtgatgggaaaccttgaaagagtaagtgaatgctcagtcttgggctcatatctgaggatg
acaagtagtccacataggcagctatacagcaggaaggttttctaa

DBGET integrated database retrieval system