KEGG   Seriola dumerili (greater amberjack): 111219668Help
Entry
111219668         CDS       T05606                                 

Definition
(RefSeq) heat-stable enterotoxin receptor-like
  KO
K12320  heat-stable enterotoxin receptor [EC:4.6.1.2]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00230  Purine metabolism
sdu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111219668
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sdu01001]
    111219668
Enzymes [BR:sdu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     111219668
Protein kinases [BR:sdu01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   111219668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase ANF_receptor
Motif
Other DBs
NCBI-GeneID: 111219668
NCBI-ProteinID: XP_022598101
Position
Unknown
AA seq 1077 aa AA seqDB search
MNTGPKMAPAGWWLCLCALGILAAPCRGIGRCLNGITMNVILLDDEESPWSLKFVRGEIL
EAIEIDSAINAAEGMKFNLTPNFGGFNTTLYRHRGCQSSTCEGVDELKNLMYSGNLGCAV
LGPTCTYASFQMVDVEKGLKLKTPIISAGSFGLSCDYTLNLQRLLPPARKISDFFILFWK
ESNRIKPAWETAYVYKKQSNSEDCFWYINALDADSSKFAQNISRTVLRKPDELRKILTSP
KNRTSNLFIMCGSPLDILEVKNGSTDADSSDNLFILIDLYNDKYYTNKTSMPSMKNVLVL
TMPNTRNYTINTDTDNNTMNDYMAAYHDAVLLTGQVMREIAKKPQSEIQQMEFVNVNYFR
NTSFNGSAGHYRLDKFGDRDVNLSIIYTTTDNKYRVLFTFDTEHNKTKVVETDPSFIWGK
RLPDYGPDTGPASYNVIVIVLAVTVVVVATIAFIFYRQNRRDRLLRKRWSHIASALITVL
EKSELNVVSLKIEDERKDTNFKIRRALYDKKIVILKELKHSDGNFNEMQRIELNAVRQID
YYTLTKFYGTVKVDHGVFGVFEYGERGSLRYVLNDKISYPEETFMDWEFKISVMYDIAKG
MSYLHASDIQVHGRLKSTNCVVDNRMVVKITDFGCNSFLSPGKDLWTAPEHLRKHGTSQK
GDVYSFAIISQEIVLRKSTFYTECCSDRAEKLSRVIMSYFRPDLNFETASEKEAEVYMLI
KSCWDEDPERRPDFKKVENCLGKIISKIHNQENESYMDNMIRRLQMYSRNLEHLVEERTA
LYKAERDRADCLNFMLLPGPVVKSLKETGVVEPELYEEVTIYFSDIVGFTTLCQYSTPME
VVDMLNDIYKGFDSIVDHHDVYKVETIGDAYMVASGLPRRNGNRHAVDICCMALDILSFM
GTFQLRHLPGIPVWIRIGIHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGHPLRIHV
SQPTINILQRTDCRFEYEIRGETYLKGKGTETTYWLTGETGEDYGLPTPPTTENFHRLQQ
DLAHMILMCLERRSRGSVRRKKRTEDDNDQESGVESESEQPEYLHLATVDNTLSTFL
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagggccgaaaatggccccggctggttggtggttgtgtttgtgcgccttgggg
attcttgctgctccgtgtcgagggatcggacgttgtttgaatgggattacaatgaacgtg
atcctgctggatgatgaggagtctccctggagcctgaagtttgtaagaggagaaatactg
gaggccatagagatagattcagccatcaatgctgcagaaggtatgaagtttaatcttacg
ccaaactttggcgggttcaacaccaccttgtatcgacatcgaggctgccagagtagcacg
tgtgagggagtggatgagctaaaaaacctaatgtattcaggcaacctgggatgtgccgtg
ctcgggcctacctgcacctacgctagcttccagatggttgatgtggaaaaaggtctgaag
ctcaaaacacccatcatctctgcaggaagcttcggtctgtcctgcgactacacactcaac
ctgcagcgcctcctgccgccggcacgcaagatctctgacttcttcattctcttctggaaa
gagagcaacaggatcaaacccgcgtgggaaacagcctatgtttacaagaaacagagcaac
agcgaggactgcttctggtatataaatgcactggatgcagactcgagcaagtttgcccaa
aacatcagtagaacggtgctgcgcaaaccggacgaactgagaaaaatactgacgtcaccc
aaaaacaggacaagcaacttgttcatcatgtgtggatcaccactggacatattggaggtg
aaaaatggctccacagatgcagacagcagtgataatctgttcatccttattgatctttac
aacgataaatactacaccaacaaaacatcaatgccatccatgaagaacgtgttggtgctg
acgatgcccaacaccagaaactacaccatcaacacagacacagacaacaacacgatgaat
gactacatggctgcgtaccatgatgcggtgctgctgacaggccaggtgatgagggaaatt
gctaaaaaacctcagtcggagattcagcagatggagtttgtcaacgtgaattacttcaga
aacacctcctttaatggatctgctggacactacaggctggacaagtttggagacagagat
gtgaatctctcaatcatttacaccactactgacaacaagtatcgtgttttattcactttc
gacactgagcacaacaaaaccaaagtggtggagacggacccgtccttcatctggggaaaa
agacttcctgattacgggccagatacaggtccagcatcttataacgtcattgtcatcgtg
ttggccgtcaccgtggttgtggtggccaccatcgccttcattttctacagacagaacagg
agggaccgtttgctcaggaagcgctggtcgcacatcgcctctgctctcatcacagtgctg
gagaaaagcgaactcaatgtcgtctctcttaagattgaagatgagaggaaagacacgaac
ttcaagatccgccgcgcgctctacgataagaagattgtaattttgaaggagctgaagcac
tcggatgggaacttcaatgaaatgcagaggatagaacttaacgcagtaagacagatcgac
tattacaccctcacaaagttttatggcacagtgaaggttgatcatggcgtgttcggggtg
tttgagtacggagagagggggtcgctcaggtatgtgctgaatgacaagatttcataccca
gaggagaccttcatggactgggagttcaagatctccgtcatgtacgatatcgccaagggc
atgtcctacctccatgccagtgacatccaggtgcacggtcgcctcaagtccaccaactgt
gtggtggacaatcgcatggtggtgaagataacagacttcggctgcaacagctttctcagc
cccggcaaagacttgtggacagctccagagcatctgaggaaacacggcacttctcagaaa
ggagacgtctacagtttcgccatcatctctcaggagattgttctcagaaagagcaccttc
tacactgagtgctgctccgaccgagcagagaagctgtccagggtcatcatgtcctacttc
agacctgatcttaactttgagacggcttcagagaaagaagcagaggtttatatgttgata
aaaagctgctgggatgaggatccagaaagaagaccggactttaagaaggtagaaaactgt
ctggggaaaatcatcagtaaaatccataaccaggaaaatgagagctacatggacaacatg
atcagacggctgcagatgtactccaggaacctggagcacctggtggaggagagaacggct
ctctacaaagctgagcgggacagggccgactgcctcaacttcatgctgcttcctggcccg
gtggtgaaaagcctgaaggagaccggcgtggtggagccggagctgtacgaggaggtgacg
atatatttcagcgacatcgttggtttcaccactctgtgccagtacagcacaccaatggaa
gttgtggacatgctcaacgacatctacaagggcttcgacagcatcgtcgaccaccacgat
gtatacaaggtggagacgataggtgatgcctacatggtggcctccgggctgccaaggaga
aacggaaacaggcacgcggtggacatctgctgcatggcgctggacatcttgtcgttcatg
ggtaccttccagctcagacacctgcctggcatccctgtgtggatacgcatcggcatacac
tcaggtccctgtgcagcaggtgttgtggggataaagatgcccagatattgtttatttgga
gacacggtcaacacggcgtctcgtatggagtcaacaggacaccccctgcggatccacgtc
agtcagcccactataaatatcctgcagaggacggactgcaggtttgagtatgagatcaga
ggagaaacatatctgaagggtaaaggcacagagacaacatactggttaacaggtgaaact
ggagaagactacggcctcccaactccacccacaacagagaacttccaccggctgcagcag
gacctcgcccacatgatcctgatgtgtctggagcgccgctctcgagggtccgtgcggagg
aagaagaggacggaggacgacaatgatcaagagtcgggggtggagtctgagagcgaacaa
ccggagtacctgcatctggccactgttgataacacgctcagcaccttcctgtag

DBGET integrated database retrieval system