KEGG   Seriola dumerili (greater amberjack): 111219813Help
Entry
111219813         CDS       T05606                                 

Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13-like
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04270  Vascular smooth muscle contraction
sdu04371  Apelin signaling pathway
sdu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111219813
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111219813
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111219813
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sdu04147]
    111219813
   04031 GTP-binding proteins [BR:sdu04031]
    111219813
Exosome [BR:sdu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111219813
  Exosomal proteins of colorectal cancer cells
   111219813
GTP-binding proteins [BR:sdu04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    111219813
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA MMR_HSR1 Roc FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 111219813
NCBI-ProteinID: XP_022598329
Position
Unknown
AA seq 377 aa AA seqDB search
MADFLPTRSVLKVCLPVCLLNSGEVEQLRKSKEIDRCLSREKPYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQQAREEFRGTIYSNVIKGVRVLVDAREKLHIPWGDPGNQQYGD
SLMAFDTRSARMASGQLETSIFLQYLPAIKALWADSGIQNAFDRRREFQLGESVKYFLDN
LDKLGELNYLPSQQDILLARKPTKGIHEYDFEIKNVPFKMVDVGGQRSERRRWFECFDSV
TSILFLVSSSEYDQVLMEDRQTNRLRESLNIFETIVNNRVFINVSIILFLNKTDLLEEKV
KSVPLKDYFPDYTGPEHSLPEIQAFMVECFRAKRRDATQKPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttcctgccgaccaggtccgtgttaaaagtttgtctacctgtctgcctgctc
aacagcggcgaggtcgaacagctgcgaaagtcaaaggagatcgacagatgtctctcccgg
gagaaaccgtatgtgaaacggttggtgaagatcctgctgctaggcgctggcgagagcggc
aagtcgactttcctcaaacaaatgcggatcatccacggccaggacttcgaccagcaagcc
cgagaggagttcagaggcacgatttacagcaacgttattaaaggtgtacgtgtattggtg
gacgcacgggagaagctgcacattccgtggggcgacccaggcaaccagcagtatggagac
agcctgatggcgttcgatacccggtcggctaggatggccagtgggcagctggagacatca
atcttcttgcagtacctgcccgcgatcaaagctctgtgggcggactcgggtatacagaac
gcctttgatcgtcgcagggagtttcagctgggtgagtcagtgaagtatttcttggataat
ctggataagcttggcgagctgaattatctgcccagtcaacaagacatcctgctggcccgt
aaacccaccaaaggcatccacgagtatgactttgaaatcaagaatgttcccttcaagatg
gtggacgtgggcgggcagcggtcagaacgaagacgctggttcgagtgtttcgactccgtc
acctcaatcctcttcctcgtctcctcctctgaatacgatcaggtgctgatggaggacagg
caaactaatcgactgcgtgaatcgctcaacatctttgagaccattgtcaacaaccgcgtc
ttcatcaacgtttccatcatcctcttcctcaacaagacagacctactggaggagaaggtg
aagagcgttccgctcaaggactactttcctgactacaccgggccggagcacagcctgcca
gaaatccaggcgttcatggtggagtgcttccgggccaagagacgagacgccacccagaag
ccactgtaccaccacttcaccacagccatcaacacggagaacatcaggctggtgttccgg
gacgtcaaggacaccatcctccatgacaatctgaaacaactcatgctccaatga

DBGET integrated database retrieval system