KEGG   Seriola dumerili (greater amberjack): 111219960Help
Entry
111219960         CDS       T05606                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00010  Glycolysis / Gluconeogenesis
sdu00562  Inositol phosphate metabolism
sdu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111219960
   00562 Inositol phosphate metabolism
    111219960
Enzymes [BR:sdu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     111219960
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     111219960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 His_Phos_1
Motif
Other DBs
NCBI-GeneID: 111219960
NCBI-ProteinID: XP_022598563
Position
Unknown
AA seq 469 aa AA seqDB search
MFSVLLPTNSLLVAALSLLLTRLSSSSLWVPDIPHIATYFGTKTRYEEVNPHLLRDLTSV
NTSVLKPPPNERCSSVHLTAVIRHGSRYPTVKNIRRIQKLSELVRREASRGSGGPEDWLR
EIQSRWDMWYTEDMDGQLVMKGREDLRHLARRLAAVFPALLSEENLRRRRISFITSSKHR
CVSSVEAFQEGLQQHWGLQEVAYSHRVDDELMRFFERCRGYVEGVEKNRTALREVERFKH
GEEMEGVRRRMAERLGLPHHRLTADLVEAAFFLCSYELSIKSLHSPWCFLFDENDAKVLE
YKSDLKQYWKRSHGHVISGLSSCPLFHHVFRTLDKAGRPRRSTEASPEPASILLGHAETL
LPLLSLLGLYKDQTPPTADNYHTQHGRSFRSGRIVPYAANLLFVLYDCQRGPRLQLLINE
SPVRFPGLEAEDAPLYRDVRATYRHLLDGCDFNRECEGRTGGRGPNTEL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgttctccgttttactgcccactaacagtttgctggtggcggctctcagtctgctcctg
acccgcctgtccagctcctctctgtgggtcccggacatcccgcacatcgccacttatttc
gggaccaagacccggtacgaggaggtgaacccgcacctgctgcgggacctgacctccgtc
aacacgtctgtcctcaaacctccgcccaacgagcgctgctcctcggtccacctgaccgcc
gtcatcaggcacggcagccggtacccgaccgtcaagaacatccgcaggatccagaaactg
agcgagctggtccggagggaagcttccagaggctccgggggccccgaggactggctgcgg
gagatccagagccgctgggacatgtggtacaccgaggacatggacggtcagctggtgatg
aagggcagggaagacctgcgtcacctggcgaggcgtctggccgccgtgtttccggccctg
ctgtcggaggagaacctgaggaggaggaggatcagcttcatcaccagctccaagcatcgc
tgtgtgagcagcgtggaggcgtttcaggagggactgcagcagcactgggggctccaggag
gtggcgtacagccaccgggtggacgacgagctgatgcgtttcttcgagcgttgccgtggt
tacgtggagggtgtggagaagaaccgcacggcactgagggaggtggagaggttcaaacac
ggcgaggagatggagggagtgaggaggaggatggccgagagactgggccttcctcaccac
cgcctcacagcggatctggttgaagcagcgttcttcttgtgttcctacgagctgtccatc
aagtctcttcactctccgtggtgtttcctgttcgacgagaacgacgccaaggtgttggaa
tacaagtcggacctgaagcagtactggaagcgttcccatggtcatgtgatcagcggtctg
tctagctgtcctctgttccaccacgtcttcaggacgctggacaaagccggacgtccccgc
aggtccaccgaggcatcccctgagcccgcctccatcctgctgggtcacgccgagacgctc
ctccccctcctctctctgctgggactctacaaggaccagactccgcccactgccgacaac
taccacacgcagcacggtagaagtttccggagcggccggatcgtcccgtacgccgccaac
ctgctcttcgtcctgtacgactgtcagcgcggaccccgcctgcagctgctcatcaacgag
tctccagttcgattcccggggctggaggctgaggacgccccgctgtaccgggacgtccgc
gccacataccgccacctgctggacggctgcgacttcaacagggagtgcgagggccggact
ggaggccgaggacccaacactgaactctga

DBGET integrated database retrieval system