KEGG   Seriola dumerili (greater amberjack): 111220138Help
Entry
111220138         CDS       T05606                                 

Definition
(RefSeq) band 3 anion exchange protein-like
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
sdu  Seriola dumerili (greater amberjack)
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sdu02000]
    111220138
   04147 Exosome [BR:sdu04147]
    111220138
   04090 CD molecules [BR:sdu04090]
    111220138
Transporters [BR:sdu02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   111220138
Exosome [BR:sdu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111220138
CD molecules [BR:sdu04090]
 Proteins
  111220138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto PTS_EIIA_2 Pox_LP_H2
Motif
Other DBs
NCBI-GeneID: 111220138
NCBI-ProteinID: XP_022598845
Position
Unknown
AA seq 841 aa AA seqDB search
MTDQKQETYWQETGRWTGYEESFDPQAGVWASSHISYLTFKSLIQLRRTMTTGVTIFDCE
ERTLATIAEKMVTEMVNKKEIRPGDREGVLKALLKNRSQSDDPESQALAGGMDLQRFSVG
ERRDASDRVEVSMVLVGALDFLEKPTVVFVRLKEAVVLDSALEAPVPVRFIFVLVGPSKT
DMDYHETGRAMAALMADRVFNQTASQAKSARELTDTMADFMDCSIVIPPTEIQSEAMLSS
IISFQKKLLQDRFQSSDPALRLESKPRRVSIATGPPPEDPLVRTGRPFGGMIRDIKRRYQ
YYKSDITDALNAQVLAAVIFIYFAALSPAITFGGLLADKVDNMMGVPELLISTSIQGIIF
CFVAAQPVLVIGFSGPLLVFEEAFFAFCRSQEIEYIVGRVWVGVWLVIIVVIIVAFEGSF
LVRFISRFTQEIFSILISLIFIYETFAKLGRIFKSHPLILNYDHLNETLENPWHPKVVET
IIYDNATGNTTVLVNTIKPPYPNTALLSMCLMFGCFFIAFFLRQFKNGTFLPGKVRRLIG
DFGVPIAIFLMIVVDYSIEDTYTQKLVVPKGLMVSNPAKRGWLINPFGEHKPFPVWLMFA
CCVPALLVFILIFLESQITTLIVSKPERKMVKGSGFHFDLLVLVGMGGLSAIFGVPWLSA
ATVRSVTHANALTVMSKGPKPVIEKVMEQRISGILVALLVGLSILMEPILKMIPMSALFG
IFLYMGVTSLNGIQLWDRILLLLIPKKYHPDEPYATRVSTGRMHLFTAIQIVCLALLWIV
KSSPVSLALPFILILTIPLRMFMTGRLFTELEIKCLDADDAKVTFEEEPGKDVYCESQMP
L
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgactgaccagaagcaggagacctactggcaggagacgggccgatggacgggctacgag
gagagcttcgaccctcaggccggggtgtgggcgtcctcgcacatctcctacctcaccttc
aagagcctcatccagctccgacgcaccatgaccacaggtgtgacgatttttgactgtgag
gagcggaccctggccaccatcgctgagaagatggtcaccgagatggttaacaagaaggag
atcaggcctggagaccgggagggagtgctgaaggctctgcttaaaaaccgcagccaatca
gatgacccagaaagccaagctctggctggtgggatggacctgcagaggttctcagtcggg
gaaaggagggatgcatctgaccgcgttgaggtctccatggtgctagtaggagccttggac
tttctggagaagcctacagttgtgtttgtgcgtctgaaggaggcagtggtgctggactcg
gccttggaggccccggtgcctgtacgcttcatctttgttctggttggccccagcaagact
gacatggactaccacgagactggccgtgctatggcggcactaatggctgacagagtgttc
aaccagacagcgtcgcaggcaaagagtgcccgagagctgacagacaccatggctgacttc
atggactgcagcatcgtcatcccacccaccgagatccagagcgaagctatgctcagctcc
atcatcagctttcagaagaaactcctgcaggacaggttccagtcctctgatcctgccctg
cgcctggaatccaaacctcgtagggtttccatagctaccgggccccctcctgaagacccc
ctggtccgtacgggtcgaccatttggtgggatgattcgagacataaagagacgctaccag
tactacaagagtgacatcacagatgctctcaacgcccaggtccttgctgccgtcatcttc
atctacttcgccgccctgtctcctgccatcacctttggagggctgctggctgataaggtg
gacaatatgatgggtgtcccagagctcctcatctccaccagcatccaggggatcatcttc
tgctttgttgctgctcagcctgtcctggtcattggtttctccggtcctctgttagtgttt
gaggaagctttctttgctttctgcaggtcccaggaaattgagtatattgtcgggagagtg
tgggttggagtgtggctagtcatcattgtggtgatcattgtggcctttgagggcagcttc
ctggtgcgcttcatctcacgcttcacccaggaaatcttctccatcctcatctccctcatc
ttcatctatgaaacctttgccaagctggggaggatctttaaatcgcatcctctgattctg
aattacgatcatctgaatgaaactctggaaaatccctggcacccaaaggtggtcgagacc
atcatttatgacaatgctaccggcaatacaactgttcttgtcaacactattaagccacct
taccccaacactgccctgctctccatgtgcctcatgttcggctgtttctttatcgccttt
ttcctgcgccagttcaagaatgggacatttcttcctggaaaggtgcgacgtttaattggt
gacttcggtgtccctatcgccattttcctcatgattgttgtggactacagcattgaagat
acctacactcagaaactcgtggttcctaaaggtctgatggtatccaacccagccaaaaga
ggctggcttatcaaccctttcggggagcacaagcctttccctgtgtggttgatgtttgca
tgctgtgtcccagccttgctcgtcttcattctcatctttctggagtctcagatcacaact
ctgattgtgagtaaacctgagaggaagatggtcaagggctctgggttccactttgacttg
ctggttttagttggcatgggagggctcagtgcaatatttggtgtgccgtggctcagtgct
gccacggtgcggtctgtcacccacgccaatgccctcactgtcatgagcaaaggaccgaaa
cctgtgatcgagaaagtgatggagcagaggatcagtggcattctggtggctttgctggtc
ggtctgtctattctgatggagccaatcctaaagatgatccccatgtcggccttgtttggg
atcttcctctacatgggagtcacgtcactaaatggcatccagctgtgggatcgtatactg
cttctgctcatccctaagaaataccaccctgatgaaccctacgccaccagagtgagcaca
gggcgaatgcacttgttcacggccatccagatagtgtgccttgcacttctctggattgtg
aagtccagcccagtatccctcgcactgcccttcatactcatcctcactatccctctacgc
atgtttatgaccgggcgtctcttcactgaactggaaattaaatgtttggacgcagacgat
gccaaagtgacatttgaggaggagccagggaaggatgtatactgtgaatctcaaatgcca
ttgtag

DBGET integrated database retrieval system