KEGG   Seriola dumerili (greater amberjack): 111220450Help
Entry
111220450         CDS       T05606                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111220450
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sdu03041]
    111220450
Enzymes [BR:sdu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     111220450
Spliceosome [BR:sdu03041]
 Complex C
  Other components
   Step II factors
    111220450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 T2SSE Flavi_DEAD ABC_tran AAA_30 AAA_19 DUF2075 AAA_7 Sigma54_activ_2 AAA_16
Motif
Other DBs
NCBI-GeneID: 111220450
NCBI-ProteinID: XP_022599265
Position
Unknown
AA seq 1192 aa AA seqDB search
MAALDEIKRLEYLSLVSKVCTELENHLGISEKDLAEFIINLAEKHPTIEEFKAVLLQNGA
EFTDTLIGNLLRLIHTMRSSPSTSKALQPEANPKSEKDKLKVKYPALCKPDDPVWMIPPP
HTDKDDEQVAAAAMKELEMLMPSVCGASSDNRSDRNSQCDRGRDADRESGCKRSRSRSRS
RDRDGETNHKRRRKRVSRWSDRPPSPNRGNNNNNNKEEDGDRWRERDRPVDRPPPDEPVV
GDIYNGKISSIMQFGCFVQLEGLRKRWEGLVHISELRKEGRIANVADVVTKGQKVKVKVL
SFTGTKASLSMKDVDQETGEDMNPNRRRNPGVEVGDENMRNPDRPNEVSTLEIEENPTEH
KRLTKITDLEKWEINQMIAANVLPKEEFPEFDEETGILPKIDDDEDEDIEIDLVDDEPPF
LRGQTKWTLNMSPVKIVKNPDGSLSQAAMMQSALAKERRELKQAARAAEMDCIPTGLNKN
WIDPMPDYEGRQIAANMRGIGAMPIDLPEWKRYALGGNQVSYGKKTELSILQQRESLPIF
KLKEQLTQAVHDNQILIVVGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAK
RVSEEYGCRLGQEVGYTIRFEDCTSTETVIKYMTHGMLQRECLVDPDMSQYSLIMLDEAH
ERTIHTDVLFGLLKKTIQKRKDMKLIVSSATLDAVKFSQYFFEAPIFTIPGRTFPVEILY
TKEPETDYLDASLITVMQIHLTEPPGDVLVFLTGQEEIDTACEILYERMKSLGPDVPELI
ILPVYSALPSEMQTRIFDPAPPGSRKVIIATNIAETSLTIDGIYYVVDPGFVKQIVYNSK
TGIDQLVVTPISQAQAKQRSGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLAST
VLSLKAMGINDLLAFDFMDAPPMETLIIAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPM
LCKMLIMSVHLGCSEEMLTIVSMLSVQNIFYRPKDKQAQADQRKTKFFQPEGDHLTLLAV
YNSWKNNKFSNPWCFENFIQARSLKRAQDIRKQMLSIMDRHKLDVVSCGKSTMRVQKAIC
SGYFRNAARKHPQDGYRTLIDQQVVYLHPSSTLFNRQPEWLVYHELVLTTKEYMREVTTI
DPRWLVEFAPAFFRVGDPTRLSRQKRMQKLEPLYSRYEEPNAWRISRAFRRR
NT seq 3579 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgttagacgaaataaaacgccttgaatatttatctttggtgtctaaggtgtgc
acagagctggagaatcatctgggaataagcgaaaaagatttggctgaatttatcatcaac
ctcgccgaaaaacacccaacaattgaggaatttaaagctgtgctattacaaaatggagca
gaatttacagatacccttattggtaatttactcagacttattcatactatgcgctcctca
ccatctacaagtaaagcacttcagccagaggcgaacccaaagagtgagaaggacaagctg
aaagtgaaataccctgctttgtgtaaaccagatgaccctgtgtggatgatccccccgcca
cacacagataaagacgatgagcaggttgcagcagcagccatgaaggagctggagatgctt
atgccaagtgtttgtggggcaagctctgataacaggtcagacagaaattcacaatgtgac
agaggtcgagatgcagacagagaaagcggatgtaagcgaagtcgctctcgctccagatca
agagatcgcgatggagaaacaaaccacaagcggagaaggaaacgagtgtctcgctggagt
gaccgtccaccaagccccaacagaggtaacaacaacaacaacaacaaggaggaggatggg
gaccgctggcgtgagcgtgatagacctgtggatcggcctccgccagacgagcctgtcgtg
ggtgacatctacaacggcaaaatcagcagcattatgcagtttggttgctttgtgcagctc
gagggcctcagaaaacgctgggagggtctggtgcacatctcagagttgcgcaaagaagga
cgcatagcgaatgtggctgatgtggtcaccaaaggccaaaaggtgaaggtcaaagtgctg
tcattcactggaaccaaagccagcctcagtatgaaggatgtagaccaggagacaggggag
gacatgaaccccaaccgaagaagaaatccaggtgttgaagttggagatgaaaacatgagg
aaccctgaccgccccaacgaagtcagcacgctggaaatagaggaaaacccaacagaacac
aaacggctcacaaagataactgaccttgagaagtgggaaattaatcagatgattgcagcc
aatgttcttcctaaagaagagttcccagaatttgacgaggagacgggaatccttcccaaa
atagatgatgatgaagatgaagacatagagattgatctggttgatgatgaaccaccattc
ctgaggggacagactaaatggaccttgaatatgagcccagttaaaatagtgaagaatcca
gacggctccctttcccaggcagccatgatgcagagcgcactggctaaggagaggcgggag
ctgaagcaggcggctcgcgcagcagagatggactgcatccctactggtctcaacaagaac
tggatagacccaatgcctgattatgaaggaaggcagatcgctgccaacatgagaggcatc
ggcgctatgcctatcgatcttccagagtggaagagatacgccttaggagggaaccaggtg
tcgtatggcaagaagacagagctctccatcctgcagcagagagagagtctgcctattttc
aagcttaaggaacagctcactcaggctgttcatgataatcagatcttgattgtagtcgga
gaaaccgggtcaggtaagaccacacagatcactcagtacctggcagaggcaggctacacc
tcccggggaaagattggctgtacgcagccccgtcgtgttgccgccatgtcagtggccaag
agagtctctgaggagtatggatgtcgtctaggccaagaggtgggttacaccattcgtttt
gaggactgcaccagtacggagacagtaatcaagtacatgacccatggtatgctgcagaga
gagtgtctggtggacccggacatgagccagtattccctcattatgctagacgaggcccac
gagagaacaatccacactgacgtgctgttcggcctcctcaagaagacgatacagaagcgc
aaagacatgaagctgatcgtgtcctctgctacactggatgctgtcaaattctcccagtat
ttctttgaagctcccatcttcaccatcccaggaagaaccttcccagtggagattctctat
accaaagagcctgagacggactacctggatgccagtctcatcactgtcatgcagatccat
ttaacagagcccccaggtgacgtcctggtgtttctgactggacaggaagagatcgacacg
gcctgtgagatcctgtacgagcgaatgaagtcactggggcctgatgttcctgagctgatt
attctgccagtttattctgccctgcccagtgagatgcagaccaggatctttgatcctgcg
cctccaggcagcagaaaggtcatcattgccacaaacattgctgagacgtctctgactatt
gatggaatctactacgtggtggatcctggttttgttaagcagatcgtgtacaattccaag
accggcattgaccagcttgtggtgactcccatatcacaggcccaggccaagcagaggtca
ggtcgagccggcagaacaggcccggggaaatgttacaggctctacactgagagagcctac
agagatgagatgctgacgaccaatgtgcctgagatccagagaaccaacttggccagcact
gtgctgtctctgaaggccatgggtattaatgaccttctggcgttcgacttcatggatgct
cctcccatggagactctgatcatagccatggagcagctttacactctgggagctctggat
gatgaaggattactcacacggctgggtagaaggatggcggagttccctctggagcccatg
ctgtgtaagatgttgatcatgtccgtccatctgggctgcagcgaggagatgctcaccatc
gtctccatgttgtctgttcagaacatcttttatagaccaaaggacaaacaggcccaggct
gaccagaggaagacaaagtttttccagccggagggagaccaccttacactgttggctgtc
tacaactcctggaagaacaacaagttctccaacccctggtgttttgagaacttcattcag
gctcgctcattaaagagagctcaggacatccgcaagcagatgctgagcatcatggacaga
cacaagctggacgtggtgtcttgtgggaaaagtacgatgcgggtccagaaagctatttgc
agcggttacttcaggaacgcagccaggaagcaccctcaggacgggtaccgtaccctgatt
gaccagcaggtggtgtacctccacccctccagcactctgttcaaccgccagccggagtgg
cttgtgtaccatgagctggtgttgaccaccaaggagtacatgcgggaggtgactaccatc
gaccctcgctggctggtggagttcgccccggctttcttcagagttggtgacccaacacgc
ctcagccggcagaagaggatgcagaaactggagcctctctacagccgctacgaggagccc
aacgcatggaggatctcccgggcctttagacgacgctga

DBGET integrated database retrieval system