KEGG   Seriola dumerili (greater amberjack): 111220806
Entry
111220806         CDS       T05606                                 

Gene name
dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00230  Purine metabolism
sdu00240  Pyrimidine metabolism
sdu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111220806 (dck)
   00240 Pyrimidine metabolism
    111220806 (dck)
Enzymes [BR:sdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     111220806 (dck)
SSDB
Motif
Pfam: dNK AAA_33 AAA_18 AAA_17 AAA_28 Thymidylate_kin
Other DBs
NCBI-GeneID: 111220806
NCBI-ProteinID: XP_022599755
Position
Unknown
AA seq 271 aa
MSFTPKRRCPDSMNDSMNDSMNDSMEKRIKRISVEGNIAAGKSTFVRFLEQESADWEVVP
EPIARWCNVQTKGSDFEELTTSQRSGGNILQMMYEKPERWAYTFQSYACISRVRAQIRSA
NGKLQEAENPVQFFERSIYSDRYIFTANLYESGCLNDTEWSVYQDWHGWLHNQFGKHIEL
DGIIYLRASPEKCLERLHLRGREEEQDIPLEYLEKLHFKHESWLQHKTMTTEFEYLNDVP
VLTIDVNENFKGNDTKRADMTEKVREFLSTL
NT seq 816 nt   +upstreamnt  +downstreamnt
atgtctttcactccgaagagacgctgcccggattcaatgaacgattcaatgaacgactcc
atgaacgactcaatggagaaaaggataaagcggatttcagtcgagggaaacattgcggcg
ggcaaatccacctttgtgcgcttcttggagcaggagagcgcggattgggaggtggtacca
gagcccatcgccaggtggtgcaatgtccaaacaaaaggcagtgactttgaggagctgacc
acatctcagaggagtggagggaacatactgcagatgatgtacgagaaaccggagaggtgg
gcctacaccttccagagctacgcctgtatcagcagggtgcgggcccagatcaggtcggcc
aacgggaagctgcaagaagctgaaaatcctgtgcagttcttcgagcgatccatctacagt
gacaggtacatctttacagccaacctctatgagagcgggtgcttgaatgatactgagtgg
tcagtgtaccaggactggcacggctggctgcacaaccagtttggcaagcacatcgagctg
gatggtatcatctacctcagagcttcacctgagaaatgtttagagagactgcacctgaga
ggcagagaagaagagcaggacattcctctggagtatctagagaagctccacttcaagcat
gagagctggctgcagcacaagaccatgactacggagtttgagtatctcaatgatgtgcca
gtcttgaccatagatgtgaatgaaaactttaagggaaatgacaccaagagagccgacatg
actgagaaggtgagagagttcttgagcacgttgtga

DBGET integrated database retrieval system