KEGG   Seriola dumerili (greater amberjack): 111221160Help
Entry
111221160         CDS       T05606                                 

Definition
(RefSeq) palmitoyltransferase ZDHHC7-like isoform X1
  KO
K20029  palmitoyltransferase ZDHHC3/7/25 [EC:2.3.1.225]
Organism
sdu  Seriola dumerili (greater amberjack)
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sdu04131]
    111221160
Enzymes [BR:sdu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     111221160
Membrane trafficking [BR:sdu04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    111221160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC DUF3615
Motif
Other DBs
NCBI-GeneID: 111221160
NCBI-ProteinID: XP_022600233
Position
Unknown
AA seq 327 aa AA seqDB search
MQSSNHRLRDMEQHHPLLSAGADVETGSLAAGVMVGSPHAGHTAGNRTLWFIQDSCGMVC
ATMTWFLVLYAEFVVNFVMLLPAKSFWYSLLNGATFNSLAVLALASHLRTMLTDPGAVPK
GNATKEYMESLQLKPGEVIYKCPKCCSIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEK
NQRFFVLFTMYIALISAHALGLSGMHFFTCIKAQWNECSEFSPGVSVLLLIFLCLEAILF
LTFTAVMFGTQIHSICNDETRGLNVLQEIERLKNEKPTWERRMRWDGMKAVFGGPPSLLW
CNPFTGLRLRRLLLLTHGRRGGSEFSV
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcttcaaaccaccgactgcgtgatatggagcagcaccacccgctgctgtcggca
ggtgcagatgtcgagacggggagcctggcagcgggagtgatggttgggagtccccacgcg
ggacacactgcggggaaccgcacactttggttcattcaggacagctgtggtatggtgtgt
gcaaccatgacctggttcctggtgctgtacgccgaattcgtagtgaactttgtcatgctg
ttgcccgccaagagcttctggtattcgctcctgaacggggccaccttcaactctctggct
gtgcttgcattggcctcgcatctgcgcaccatgttgactgatccgggtgcagttccaaag
ggtaacgcaaccaaggagtacatggagagcttgcagctgaagcctggtgaggtcatctac
aagtgcccaaagtgctgcagtatcaagcctgagagggcacaccactgcagtatttgtaaa
agatgcatccggaagatggatcaccactgtccctgggtcaataactgtgtgggagaaaag
aatcagagattctttgttctgttcactatgtacatagccttgatttctgcccatgccttg
ggcctcagtggaatgcacttcttcacttgtattaaagcccagtggaacgagtgcagtgag
ttctctccaggggtgtctgtgctgctgttgatcttcctctgtctcgaagccatcctcttt
ctcactttcacagctgtaatgtttggtacgcagatccactccatctgcaatgacgagacg
aggggtttgaatgtcttgcaggagatcgaacgtcttaaaaatgagaagcccacatgggag
cgtcgcatgagatgggacggaatgaaagctgtgtttgggggtccgccctctctgctatgg
tgcaatccattcacaggcctgcgtttgcgacgtctgttgctgttgacccatggtcgccgc
ggtgggtctgagttttctgtctga

DBGET integrated database retrieval system