KEGG   Seriola dumerili (greater amberjack): 111221621Help
Entry
111221621         CDS       T05606                                 

Gene name
espl1
Definition
(RefSeq) separin
  KO
K02365  separase [EC:3.4.22.49]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04110  Cell cycle
sdu04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111221621 (espl1)
   04114 Oocyte meiosis
    111221621 (espl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sdu01002]
    111221621 (espl1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sdu03036]
    111221621 (espl1)
Enzymes [BR:sdu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     111221621 (espl1)
Peptidases [BR:sdu01002]
 Cysteine Peptidases
  Family C50: separase family
   111221621 (espl1)
Chromosome and associated proteins [BR:sdu03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    111221621 (espl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT Enkurin
Motif
Other DBs
NCBI-GeneID: 111221621
NCBI-ProteinID: XP_022600796
Position
Unknown
AA seq 2176 aa AA seqDB search
MKCLKVDEYVKRIASVEETEHLLQELEDYVKRRPGLQGRTLCDRVIRACNHQLGVGSLDF
DHVSQLVKLVELSLNGYDISAALVPQSSPLYMEKIIFHIVKKLSSLEAHILCSYVSGLLY
SRLTTAQQAEDYYVLLRSCFSVLWTGLSAAKDRKILNPRDKFHCQMQALSFLLLLDTESA
TTSFSKAPIYTEDAIAEFESSCGAVTNEDASFLLQEVRSLFNKCQTGGQGLEGDEARQCI
EKSSVYVRSEMLLIIVKVLCKAGHYDLASTFLNETESKVRDCADCQCTALLLGKWVVKVH
STMKSGEENAQALTECARVLRSLPEDLGGREAHAVLEGCALVVWAVENGHNKGLSGPVLL
AWFSFLEEQQELILKMLKRNLTCQAESSRLQQALCFSIYQGFVFAYESMLASQLENSDTL
DRVLLYCQATAGQMMTELRKLSSESLLIKAVIAVSNLVCGLYNRRLYDQAFTLVEILCRD
LCKNCPVSLSVDRLSRPFMLAVQTSRRAGQLERALDWVILWLKALGDNVPTHMAEPVSLW
VKTKTDAARNSEEDIRLRTLRDGFGPDVPDEGVMLCLLEEELRAYKEVAGDTAQERYNTL
CDLLDICHEGSSHTHLRAVYLCEMAQVVCFQDFSEQTDCSAVDFTHEALRLLEEERETAE
NADRLKDDKAHALLWLYICTLEKNLQEAIEKDKKLRELREQTRCVANPIGTNDFDYEDKQ
KTQDNIMVYEGLHFNLAAENKLCKPLERALDEWSALLQSQVLPSVRNPKQTCSSIALTAA
LFRLMGKPLKALEAYRLAIGLSHHLADSHSRASFLCQSTSLLLDIGAPDLALGQLEQAEK
NLTSDTTGEGPSSLSMLAILLKAQYCYSTGQVDRGVPYLCEVLKEVNEQRQSKSWYLLRA
RALQTCSAYLSLDTDALPQAERSRITQHGINSPDIALYESLKLLCSLLVTLVGKGLYGTN
SSSSDVRFIDQGDNLVLKWQLLSDLLNCSMKMVAVRSSCGAINDARLQCLEALKLAIKLQ
ALSQCAELLVMKAELELMQGEREESRLDLDKVRNLLELCTDFSDQVQKTEVKIKPRKGRP
VQKSQSPLPTMEDDLKGILSTRWIATEPVVKDLTSSPPLKAQPRRWLSSLAHESNCQCPC
CSEPCLGRATARWAATQAELVLQLDPNEAKAGLKLQWATLARCKSVTAKLGAKLAKLFPP
CGPTKGSSKPSLMQDLVGRVYLCMALSGLEPRLNKVCGIWKVLEAGLAFVDSTPSPVLRP
VRAGLMATKAIVSLITLASKQGCNPEDLFSNAWTWNTPKEDKELKSEQKMVSSSSLLKKS
KDSIKNPDIPNKTKEAKKVKAVKPKIEVTSSSRGKGLVPMTPVMVKSKPSVKELGTFDFN
TVVPTLACTPVQKVKAPASAQKAPRTASKLQFHVYEELSPVQDKAQPVPAAPRRTKKSRF
KVEFSDESDSEANTLAEPKEKTRVPKKQPATRRAAHNSKTAPDPPAEKVLPKRQAKGKST
AVPRTTSSEDEKSLVCQPPSTRRGRTRRELSRAEAETLEEPDKMRTIEEEINEVLDISIE
QLRTSDTETEDNPASSKYTDFEVLRRDMCCDLERDDLSELRSRGHLREGPQTHLSHPDTR
PDNLSLEDVQLLLRSAWLALQHFPSPTIYPTLSTLLALALGQHDPITTAMLHAQSLGITS
RHRTIRHLASCLKKLRKSSNELTDKMDALSLNELSPTKSKNSTEQRLAQLENIFSFPTAD
SSSFPQNHCQEFIQQLQLLPQGVTVCVMSVLGVKPGEMGNSIILTRLEKGSDPVTVHIPT
SKQQVMHPISWLVQEMDSIQVEQKVVSCVSEKAKWWEGRRALDSRVEQLLKDMEELLGCW
KSFLLPFSSDPELSNQAQRLCKALSARGVMCSEEMLKAVLSAFPVLSQEDIQRFSLGVSP
QWDMECDQLLHTAVSRLSERDEPHGHVVLILDKYLQKLPWESVSILKSRSVSRMPSLHSL
IGLSIQKETDSHSILKQGVDTKKVFYVLDPDANLGNSQDRFKEWFSSKLDWEGVCGVAPD
SGQLEEAVATKDLYIYVGHGAGARFLDSQVVLKRQMKAASLLFGCSSAALAVRGDQEGQG
IILSYLIAGCPFVLGNLWDVTDRDIDRFTKALLESWLSAGSGAPLLDYMGPSRQATHLKH
LIGAAPVVYGLPVHLQ
NT seq 6531 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgtttgaaagtggacgagtacgtaaagcggatcgcttctgtggaagagacggag
catttacttcaagaactagaggattatgtgaagcgtcgaccaggccttcagggtcgcacg
ctgtgtgacagggtcatcagagcctgtaaccatcaacttggagttggatctcttgacttt
gaccatgtcagtcagttggtaaagctagtggagctttcccttaatggctatgatatttct
gcagcacttgttcctcagagcagtccactgtacatggaaaagattattttccatattgtc
aagaagctaagctccctagaagcccacattctatgcagctatgtatctgggttgctttac
agcaggcttaccactgcacaacaggcggaggactactatgttcttttgcggagctgcttc
tcagtgctctggactggactctctgctgccaaagacaggaaaatcctgaatccccgggat
aaattccactgccagatgcaagctctgagctttctcctcttgttggacacagaaagtgca
actacctccttctcaaaagctcccatttacacagaggatgccattgctgaatttgagagt
agctgtggagcggtgaccaatgaggatgcttcctttcttctccaggaagtgcgctcactt
ttcaacaaatgccagactggtggtcaaggcttggagggggatgaggccaggcagtgtatt
gagaaatcaagtgtatatgtgcgttctgaaatgctgctgattatagttaaggtgctttgt
aaagctgggcactacgatctggcctccaccttcctgaatgaaactgagagcaaggtcagg
gactgtgctgactgtcagtgtacagctctgttgcttggcaagtgggtagtaaaagttcat
tcaacaatgaagtctggtgaggagaatgcccaggctttgacagagtgtgccagagtcttg
aggtctctcccggaggacctggggggcagagaagctcatgcagttctggaagggtgcgca
ctcgtggtgtgggctgttgagaatggtcacaacaaggggttaagtggtcctgtactcctt
gcctggttttctttccttgaggagcaacaagagctaattttaaaaatgctaaagaggaat
ttgacatgccaggctgagagcagcagactgcaacaggccctttgtttcagtatttaccaa
ggctttgtatttgcttatgagagtatgctcgcatcacagttggagaacagtgatacactg
gacagagtgctgctgtactgccaagccacagctggacagatgatgactgaactgcgcaag
ctgtctagtgaaagccttctcatcaaagcagttattgctgtgagcaacttagtttgtgga
ttgtacaaccggcgcctctatgaccaggcgttcacgctagttgagatcctctgcagggat
ctatgcaagaattgccctgtctcgctctctgttgataggttgagcagacccttcatgctg
gctgttcagacttctcggcgtgctggacaactggagcgagcactggactgggtgattctg
tggctgaaagctctgggggacaacgttcctacacatatggctgaaccggtctctctttgg
gtgaaaacgaagactgatgcggcacgtaactctgaggaggacatccgactcaggacattg
cgtgatggttttggtcctgacgtccctgatgaaggagtaatgctgtgccttttggaggaa
gagctgcgtgcctataaggaggtggcaggggataccgctcaggagcgttacaacacactc
tgcgatctgttggacatctgccatgaagggagctcccacactcacctacgtgctgtctac
ctctgtgaaatggcccaagttgtgtgtttccaggatttcagtgaacagactgactgctct
gcagttgattttacccatgaagctttacgcctactggaagaagaacgagagactgcagag
aatgctgacagactgaaggatgacaaggcccatgctttactttggctgtatatctgtact
cttgagaagaatcttcaggaggccattgagaaggacaaaaagctgcgagagttgcgtgaa
cagacacggtgtgtggccaatcccataggaaccaatgattttgattatgaagacaagcag
aagacacaagacaacattatggtctatgaaggcctgcatttcaacctggctgcagagaac
aaattgtgcaaacctttggaaagagccctggatgagtggtctgctcttctgcagagtcaa
gttctgccctctgttaggaaccccaaacagacctgtagctccattgctttgactgcagct
ctcttcagactcatgggaaagcctctaaaggctttggaagcttaccgacttgctattgga
ctttcacatcatcttgctgactcccacagtcgtgccagcttcctctgtcaatcaaccagc
ctccttcttgatattggtgcccctgatctggctttgggccagttagagcaagcagaaaaa
aatcttacctcagataccactggtgagggaccttcttccctctctatgctggccattctg
ttgaaagctcagtactgctacagcacaggacaggtggaccgcggagtgccctatctgtgt
gaagtgcttaaagaagtgaatgagcagagacagtcaaaaagctggtacctgctgcgtgct
cgggcactgcagacatgcagcgcctacctgagtttggacacagatgcactgccacaagct
gagcgcagccgtataacacagcatggtataaatagcccagacattgccctgtatgaaagc
ctgaagcttctctgcagcctgctggtcactttagtggggaaaggcctgtacgggaccaat
agcagcagctcagatgtgcgcttcatcgaccaaggagataacctggtgctgaaatggcag
ctgctctcagacctgttgaactgctctatgaagatggtggctgttcgaagcagctgtggg
gccatcaatgatgccaggctccaatgcctagaagcccttaaactggccatcaagctacaa
gcactcagccaatgtgctgagctgctggtgatgaaagctgagttggagctaatgcaaggg
gagagagaagaaagtagacttgatttagacaaagtcagaaatcttctggaactctgcaca
gatttttctgatcaggtgcagaagacagaggtgaaaatcaaaccaaggaaaggtcgccca
gtgcagaaatctcagtctcccctgcctactatggaggatgatcttaagggcatcctgagc
actaggtggattgctacagaacctgtagttaaggatctgactagctccccgcctctcaaa
gcccagcctcgccgctggctctcctccctggcgcatgaatctaactgccagtgcccctgc
tgctctgagccctgtctgggccgtgccactgctcgctgggctgctacacaggctgaattg
gttctccagctggatcctaatgaagccaaggctggtttgaaacttcagtgggcaacatta
gcccgctgtaagagtgtcactgccaaacttggggcaaaattggctaaactcttccctccc
tgtggccccaccaaaggctcctctaaaccctccctgatgcaggacttggtgggccgtgtg
tacctttgcatggctctgtctgggctggaaccaaggcttaacaaggtctgtggtatatgg
aaagtactggaagccggcttagcatttgttgattccactccctctcctgtcttaagacca
gtgagagcaggcctaatggcaactaaagccatagtatcattgatcaccttggcttccaaa
cagggctgcaacccagaggacctcttctcaaatgcttggacttggaacacaccaaaagaa
gataaagaactgaaatcggaacagaaaatggtgtcttcctcgtccttgcttaaaaagtct
aaagattctattaaaaaccctgatattcccaacaaaacaaaggaggcaaaaaaggtgaag
gctgtcaagcccaagattgaagtgacaagctcctccagaggaaagggactggttcctatg
acaccagtaatggttaagtcaaagccctctgttaaagagcttggcacttttgacttcaac
acagtggtacctactttggcttgtactcctgttcagaaggtgaaagctcctgcttcagcg
cagaaagcaccgaggactgcctctaagctacagtttcatgtgtacgaagaattgtcacca
gttcaagacaaagctcaacctgtgcctgccgcccccagacgcacaaagaaatcacgtttc
aaggtggagtttagcgatgagagtgactcagaggccaataccctagcagagcccaaagaa
aaaacacgtgtccctaaaaagcaaccagccacgagaagagctgcccacaattctaaaaca
gccccagatccaccagcagagaaagtcctgcccaagagacaggccaagggtaaaagcact
gcagtgcctcggaccacgtcttctgaagatgaaaagagtttggtctgtcagcctccctca
acaaggcgaggaagaaccaggagggagctgtccagggcagaagcagaaactctggaagag
ccagacaaaatgaggaccattgaggaggaaattaatgaagttctggacataagcattgag
cagcttaggacatcagacaccgagactgaagacaatcctgcttcaagtaaatatactgat
tttgaggtcttgcggagggatatgtgttgtgacttggaaagagacgacttgtctgaactg
aggagtagaggtcatctgagagaaggtccacaaacccacctctctcatccagacaccagg
ccagataatctctctctggaggatgttcagttgttgctgcgttcagcctggctggccctt
caacacttcccttctcccaccatttacccaaccctctctactcttctggctttggcactc
ggacagcacgaccccataactacagccatgctacatgcccagtccttgggcatcacaagc
cgtcatcgcacaatcaggcatttagccagttgtctcaaaaagctgagaaagtcgtcaaat
gagttgacagacaagatggatgctctgagtctaaacgagctcagtccgaccaaatccaag
aattctaccgaacagaggttggctcagttggagaacatcttttccttccctactgctgac
tcctcatctttccctcagaaccactgccaagagtttatccaacaacttcaactccttccc
caaggggtaacggtgtgtgtgatgtctgtgcttggagtaaaacccggggaaatgggcaac
agcattatactgacacgtcttgagaaaggatctgaccctgtcactgttcatatccccaca
tctaagcagcaggtgatgcaccccattagttggctcgtgcaggagatggacagtattcag
gtggaacagaaggttgtgagctgtgtgtctgagaaagcgaagtggtgggaaggccgccgg
gcacttgactctcgagttgagcaactgttgaaagacatggaggaattgcttggatgctgg
aagagcttccttcttcccttttcatcagatccggagctctccaatcaggcccagcgcctt
tgcaaggccttgtctgccagaggagtgatgtgtagtgaggagatgttgaaggctgtgctg
tctgcatttcctgtactctcccaagaagacatccaaagattttctcttggagtttctcca
cagtgggacatggagtgtgaccagcttctccatacagctgtgtcccggctttcagagaga
gacgaaccccacggtcatgtggttctcattctggacaagtaccttcagaagttaccatgg
gagagcgtctccatcttaaagtctcgttcagtcagtcggatgccttctctgcactcacta
attggactgagcattcagaaagagactgattctcactccatcctgaagcaaggtgtggat
acaaagaaggtgttttatgtgctggaccctgatgccaatttaggaaactctcaggaccga
tttaaggaatggtttagcagtaaactggattgggaaggtgtatgtggtgttgctcctgac
tcaggtcagctggaagaagctgtggcaaccaaggatctgtacatttacgtgggtcatggt
gcaggcgcccggttcctagacagtcaggtggttctgaaacggcagatgaaagcagcctct
cttctcttcggctgcagtagtgctgctctggcagtgcgcggggatcaggaaggacaaggc
atcatcctcagctacctcatcgcaggctgcccctttgttttgggaaatctgtgggatgtg
acagatcgggatattgatcgtttcactaaagccttgttggagtcctggttatctgctggg
tctggagctcccctcctggattatatgggaccatcgcgtcaggctacacacctgaaacac
ctcataggagctgcacctgtggtctatggattacctgtccacctgcagtag

DBGET integrated database retrieval system