KEGG   Seriola dumerili (greater amberjack): 111222149Help
Entry
111222149         CDS       T05606                                 

Definition
(RefSeq) heat shock cognate 71 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu03040  Spliceosome
sdu04010  MAPK signaling pathway
sdu04141  Protein processing in endoplasmic reticulum
sdu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111222149
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111222149
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111222149
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111222149
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sdu01009]
    111222149
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sdu03041]
    111222149
   03009 Ribosome biogenesis [BR:sdu03009]
    111222149
   03110 Chaperones and folding catalysts [BR:sdu03110]
    111222149
   04131 Membrane trafficking [BR:sdu04131]
    111222149
   03051 Proteasome [BR:sdu03051]
    111222149
   03029 Mitochondrial biogenesis [BR:sdu03029]
    111222149
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sdu04147]
    111222149
Protein phosphatases and associated proteins [BR:sdu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     111222149
Spliceosome [BR:sdu03041]
 Complex B
  Other components
   Prp19 complex
    111222149
 Complex C
   Prp19-CDC5 complex
    111222149
Ribosome biogenesis [BR:sdu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    111222149
Chaperones and folding catalysts [BR:sdu03110]
 Heat shock proteins
  HSP70 / DNAK
   111222149
Membrane trafficking [BR:sdu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    111222149
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    111222149
Proteasome [BR:sdu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    111222149
Mitochondrial biogenesis [BR:sdu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    111222149
Exosome [BR:sdu04147]
 Exosomal proteins
  Proteins found in most exosomes
   111222149
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR
Motif
Other DBs
NCBI-GeneID: 111222149
NCBI-ProteinID: XP_022601450
Position
Unknown
AA seq 650 aa AA seqDB search
MSKGAAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFEDPVVQSDMKHWPFNIISDSGRPKVEVEYKGETKSFYPEEIS
SMVLTKMKEIAEAYLGVSVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA
IAYGLDEKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRA
RFEELNGDLFRGTLDPVEKSLRDAKMDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
RSINPDEAVAYGAAVQAAILCGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQRDKVSAKN
GLESYAFNMKSTVEDEKLAGKIGDDDKQKILDKCNEVISWLDKNQTAEKDEYEHQQQELE
KECNPIITKLYHSAGDMPGGMPSGMPGSFPGAGGAPSGGGSTGPTIEEVD
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaggggcagcagttggtatcgatcttgggaccacctactcctgtgttggtgtg
ttccagcatggcaaagttgaaatcattgccaatgaccagggtaacaggaccacacccagc
tacgtggccttcacagatactgagaggctaattggagatgcagccaagaatcaggttgcc
atgaaccccaccaacacagtctttgatgctaaacgtttgattggcagacgatttgaggat
ccagtagttcagtctgacatgaagcattggccatttaatattatcagtgatagtggtcgc
cccaaagtggaggttgaatacaaaggcgaaaccaaaagcttctacccagaagagatctct
tccatggtgctgacaaaaatgaaggagattgctgaggcctaccttggggtgtctgtgtca
aatgctgttatcacagtacctgcatactttaatgactctcaacgtcaagcaaccaaggat
gctggaaccatatctggtctaaatgtgttgagaatcattaatgaacccactgcagcagct
atcgcttatggtttggatgagaaggttgggtcagagaggaacgttctcatctttgatctt
ggtggtggcacttttgacgtgtccatcttgaccatcgaggatggtatctttgaggtcaag
tctactgctggagacactcatcttggcggggaagatttcgacaaccgcatggtcaaccat
ttcatcgctgagttcaaacgcaagtacaagaaggacatcagtgacaataagagagctgtc
cgtcgtctgcgcaccgcttgtgagagggcaaagcgcacactgtcttccagcacccaggcc
agcattgaaattgactctctgtatgagggagttgacttctacacctccatcaccagggct
cgttttgaggagctcaatggagacctcttccgtggcactttggaccccgtggagaagtca
ctccgtgatgccaaaatggacaagtcccagattcatgacattgtgttggttggtggctcc
acccgtatccccaagatccagaagttgctccaggacttcttcaatggaaaggagctcaac
aggagtatcaatccagatgaagctgtggcctatggagctgctgtccaggctgctattctg
tgcggtgacaagtcagaaaatgtgcaggacctgctgcttctggatgtcacccctctgtcc
ctgggtattgagacagctggaggtgtcatgactgtcttgatcaaacgtaacaccaccatt
cctaccaagcagacccagaccttcaccacctactctgacaaccagcctggtgtgctcatc
caggtttatgagggtgagcgcgctatgaccagggacaacaacctgctgggcaaatttgag
cttacaggcatccctcctgctcctcgtggtgttccccagatcgaggtgacattcgatatt
gatgccaatggcattatgaatgtctctgctgtcgacaagagcactggaaaggagaacaag
atcaccatcaccaacgacaagggtcgtctgagcaaggaggacattgaacgcatggtccag
gaagctgagaagtacaaggcagaggatgacgttcagcgtgacaaggtgtctgctaagaac
ggcctggagtcgtatgctttcaacatgaagtcaactgtggaggatgagaagcttgctggc
aagatcggtgatgatgacaagcagaagatcttggacaagtgcaatgaggtcatcagctgg
cttgacaagaaccagactgcagaaaaggatgaatatgaacatcagcaacaggagctggag
aaagagtgtaaccccatcatcaccaagctgtaccacagtgctggtgacatgccaggtggg
atgcccagtggaatgccaggcagcttccctggagctggtggcgctcctagtggcggtgga
tccactggaccaaccatcgaggaagtggattaa

DBGET integrated database retrieval system