KEGG   Seriola dumerili (greater amberjack): 111222365
Entry
111222365         CDS       T05606                                 

Gene name
tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00100  Steroid biosynthesis
sdu01100  Metabolic pathways
Module
sdu_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    111222365 (tm7sf2)
Enzymes [BR:sdu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     111222365 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT DUF4083
Other DBs
NCBI-GeneID: 111222365
NCBI-ProteinID: XP_022601795
Position
Unknown
AA seq 477 aa
MTAEGSDWPRDDSVLEDVSRGRVLLHAAGWMFRSSTDAQSRLQLRVTHRRAIMRPNSQAA
KHRSSHDTEREFGGTLGAVCIPIFLPLTVLFLICVSRSPEASVLQWPPPLPSADQLWEPL
APVLLLGWIGLHALLYLTPVGKVSEGLVLRDGTRLKYPINGFHGLCISGVLLMLLLGLGA
PLGYLFELLLPLAVCAIAVSFLLSVYLYIRSFWAPSHALALGGNTGNPLYDFFIGRELNP
RIGNFDLKYFCELRPGLIGWVVINLGMLMKEVELRGSPSLAMILVNSFQLLYVADALWNE
EAVLTTMDIVHDGFGFMLVFGDLAWVPFTYGLQAAFLVVHPQALSSLGAAAIIALNGIGY
YIFRKSNSQKNQFRRDPSHPSVARLETIATATGKRLLVSGWWGLVRHPNYLGDLLMALAW
SLPCGFSHLLPYFYVIYFTVLLIHREARDERQCRAKYGLAWDTYCRRVPYRIFPYIY
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgaccgcggagggatctgattggccgagagacgattccgtgctggaagacgtgagccgg
gggcgtgtccttctgcatgctgctggatggatgttcaggagtagcactgatgcacagtcc
cgtctgcagctccgtgtcacacaccggagagcaataatgaggccgaacagtcaagcagcc
aaacacagatcctcacacgacacagagagggagtttggaggaaccctgggtgccgtatgt
attcccatctttcttccgttgacggtgctgttcctgatctgtgtgagtcgatcccctgag
gcctctgttctccagtggcctcctcccctcccctccgctgatcagctgtgggagcctctg
gcccccgtgcttctgctgggatggatcggtctgcacgccctcctctatttgacgccagta
gggaaggtgtctgaaggattagtgctgagggatggaacacgcctcaagtatcccataaat
ggttttcatggcctgtgcatcagtggtgtgctgctgatgttgttgctggggctcggggct
cctcttgggtatctgtttgagctgctgttgcctctggcagtgtgtgcaatagcagtgtca
ttcctgctctccgtctacctctacatccgctctttttgggcaccttcccatgctctcgct
ttgggaggcaacacaggaaatcccctctatgacttcttcatcggacgggagttaaatcct
cggatcggaaactttgacctcaaatatttctgtgagctcagaccgggtctgattggctgg
gtggtcataaacctcggcatgctgatgaaagaggtggagcttcgaggttccccctccctc
gccatgatactggtcaacagtttccagctgctgtacgtggcagacgctctgtggaacgag
gaggctgttctgacaaccatggacattgtgcatgatggttttggcttcatgctggtcttt
ggagacttggcctgggtccccttcacatacggcctgcaggcagccttcctggtcgtgcac
ccgcaggccctcagttcactcggagccgcagctataatagcactgaatggtattggatat
tatattttcagaaagtccaactcgcagaagaaccagttcagacgagacccttcacatccg
agcgttgcaaggctggagaccatcgccacagcaacagggaagcggctgctggtgtccggt
tggtggggtctcgttcgtcatcccaattacctcggtgacctgctgatggcgctggcgtgg
tccctgccctgtggattctcacatctgctgccgtacttctacgtcatatatttcaccgtg
ttgctgattcaccgagaggcccgtgatgagagacagtgcagggccaaatacggactggcg
tgggacacgtactgtcggcgcgtcccctacaggatcttcccttatatctactga

DBGET integrated database retrieval system