KEGG   Seriola dumerili (greater amberjack): 111224094
Entry
111224094         CDS       T05606                                 

Gene name
mecom
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1 isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111224094 (mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sdu03000]
    111224094 (mecom)
Transcription factors [BR:sdu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    111224094 (mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_6 zf-H2C2_5 zf-C2H2_8 zf-BED PyrI_C
Other DBs
NCBI-GeneID: 111224094
NCBI-ProteinID: XP_022604203
Position
Unknown
AA seq 1081 aa
MKAEEYSCDTMAPDIHEERQYRCEDCDQHFESRNQLLDHQKQPCGMPPSSFLNPGGDSDL
KAQEPQDLRPLHMSHGLHECKECDQVFPDVQSLEAHVLSHSEEREYKCDQCPKAFNWKSN
LIRHQMSHDSGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACSDCGKTFATSSGLK
QHKHIHSSVKPFMCKSLRPYLCEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFST
TSSLNKHRRFCEGKNHFTAGGLFAQGMPLPGAPGLDKSALAMGHSSAGLADYFGASRHHG
GLTFPAAPAFPFSFPGLFPSGLYHRPPLIPATTSPVRQPSHAPITGPGAELSKSPLLPPS
PGTQETRELLKALRKDGGSPGSQMPSSELHTQSSSSSTKQRNKQSDQSESSDLDDVSTPS
GSDLESTSGSELESDMDSERERGAARENGKGPKRKASEGGPQSPSLTGSSAAKDFPGPSL
IPSSLDEHTAVTGAVNDSIKAIASIAEKYFGSTGLAGLQDKKVGSLPYPSMFPLPFFPAF
SPPVYPFPDRDLRPPGLKGEPQSPADDGKKAQGKSSAESPFDLTTKRKEEKSAPFTPSKP
EASHSVGQDQPLDLSLGTRGRGRHPREEETKKNLNYEEEKGVVEIPKADTSLQHARPTPF
FMDPIYSRVEKRRMSDPFETLKDKYMRPAPGFLFHPQFRLPDQRTWMSAIENMAEKLETF
GSLKPESGDLLRSVPSMFDFRAPPSALPETLLRKGKERYTCRYCGKIFPRSANLTRHLRT
HTGEQPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHEN
GNLSGTAMSSPQSELDSSSAILDDKEDSYFNEIRNFIGNTGQNQTSPDPSEEGLNGGPFE
EEKPLMASHVSRDLEDEEAEELGADEEEGEEPSNTPGKPEGEVLPSNLSDDIIQDEMDFT
GPNDLNLNCKTSPRGYKDEEEQSGYSALDHIRHFSDMRKLEESELSEGDGDEDDGSFGSP
SLTEAVKQPLFRKSKSQAYAMMLSLAEKDSLHPATHTPATMWHSLARAAAESSAIQSLSH
V
NT seq 3246 nt   +upstreamnt  +downstreamnt
atgaaggctgaagagtattcatgtgacaccatggctcctgatattcatgaggagaggcag
taccgctgtgaggactgtgaccagcactttgagtcccgcaaccagctgctggatcaccag
aagcagccatgtgggatgcccccctcctctttccttaacccaggtggggacagtgaccta
aaggcccaggaacctcaagacttgcgacccctccacatgtcccatggtctacacgagtgt
aaggagtgtgaccaggtctttcctgacgtccagagcctggaggcccatgttctctcccac
tctgaggagagggaatataagtgtgaccagtgccccaaggccttcaactggaaatcaaac
ctgatccgacatcagatgtcacatgacagtggcaagcactacgaatgtgaaaactgctca
aagcaggtgttcacagaccccagtaacctgcagaggcacatccgctcacagcacgtcggg
gcacgggcccacgcctgctccgactgcggcaagacgttcgctacgtcttcgggcctcaag
cagcataagcacatccacagcagtgtcaagcccttcatgtgtaagtcactaagaccctac
ctatgcgaggtatgccacaagtcctacacccagttttctaacctgtgtcgccacaaacgc
atgcatgctgactgccgcacacagatcaagtgcaaggactgtgggcagatgttcagcacc
acgtcctccctcaacaagcaccggcgcttctgtgaaggaaagaaccatttcacagcaggg
ggcttgtttgcccagggtatgccactccctggggcccctggcttggacaaatcagctctg
gcgatgggccacagcagtgctggactggctgattactttggggccagtcgccaccatggc
gggcttaccttccctgctgccccagcatttcctttcagcttccctggcctcttcccctct
ggactctaccaccggccaccgctcattcctgccaccacctctcccgtcagacaaccgtcc
catgcacccattaccgggcctggtgcagagctaagtaagagtcccctgctgcctccgagc
cctggcactcaggagacccgagagctcctcaaagctctccgtaaagatggcggttcacct
ggcagtcagatgccaagctcagagctccacactcagagctcctcatcttccacaaagcag
cgaaacaagcagagtgaccagtctgagagcagcgacctggatgatgtcagcacgcccagc
ggcagcgatctggagagcacatcaggctccgagctggagagcgacatggacagtgagagg
gagaggggggctgctcgagaaaatggcaaaggccccaagaggaaggccagtgagggaggc
ccccagagccccagcctgacgggcagcagtgctgctaaagactttccaggcccttccctc
atcccatcctcgctggacgagcacacagctgtaacaggggctgtgaatgactctattaag
gccattgcctccattgctgagaagtactttggctccacagggctggctggcctacaggac
aagaaggtcgggtctctgccctatccctccatgttcccactgcctttcttcccagctttc
tctcctccagtttaccctttcccagacagggaccttagacctccaggcctgaagggcgag
ccacagtctccggcagatgacggtaagaaggcccagggaaaatcttcagccgagtcacca
tttgacctcactaccaagcgaaaggaggaaaagtcagccccattcactccctccaaacca
gaggcctcccactctgttggtcaggatcagccgctagacctgagcctcggcaccagggga
cgtggacgccatccaagagaggaggagacaaagaagaacctgaattatgaagaggagaag
ggagtggtggagatcccaaaggcagacacctccttacagcatgccaggcccacccctttc
ttcatggaccctatctacagcagggttgagaagaggagaatgagcgatccgtttgagact
ctgaaagacaagtacatgcggccagctccaggcttcctcttccatccacagtttcgtttg
ccagatcagagaacttggatgtcggccatcgagaacatggcagagaagctggagacgttt
ggctccttgaaaccggagtctggcgacctgctgcgctccgtcccctccatgtttgatttc
agagccccaccctctgcacttccagagacgctgctgcgcaaaggcaaggagcgctacaca
tgcagatattgtgggaaaatattcccgcgctctgccaacctgacccgccacctcaggact
catacaggagagcaaccatataggtgtaaatactgcgaccgctccttcagcatctcctcc
aacctgcaacgtcacatccgcaacatccacaacaaggagaagcccttcaagtgccacttg
tgtgaccgttgctttggtcagcagaccaacttggaccgtcacctcaagaagcatgagaat
ggcaacctgtcaggcactgcaatgtcgtctcctcagtctgaactggacagtagcagtgcc
atattggacgacaaagaagactcttattttaatgaaataagaaatttcatcggcaacacc
ggccagaaccagacatccccagacccgtctgaggaagggttaaatggcgggccatttgaa
gaagagaagcctctgatggccagccatgtgtcacgtgacctggaagacgaggaggcggag
gagcttggtgctgatgaagaagaaggggaggagcctagcaacacccctgggaaaccggaa
ggcgaggtgctcccaagcaaccttagtgatgacatcatacaagacgaaatggacttcact
gggccaaatgacttgaacctcaactgcaaaacctctcctagggggtataaggatgaggag
gagcagagcggctactcagccctggatcatattcgtcacttttcagacatgcgcaagctg
gaggaaagtgaactgagcgaaggagatggagatgaggacgatggatcatttggctccccc
tccctgaccgaggcagtcaaacagccactctttaggaaatctaagtctcaggcgtacgcc
atgatgctgtctctggctgaaaaggactctctccacccagccacccacaccccagccacc
atgtggcacagtctggcacgggctgctgctgaatccagcgccatccagtccctcagccat
gtatga

DBGET integrated database retrieval system