KEGG   Seriola dumerili (greater amberjack): 111226505Help
Entry
111226505         CDS       T05606                                 

Definition
(RefSeq) glutamate receptor 1-like isoform X1
  KO
K05197  glutamate receptor 1
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111226505
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sdu04040]
    111226505
Ion channels [BR:sdu04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   111226505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF2061
Motif
Other DBs
NCBI-GeneID: 111226505
NCBI-ProteinID: XP_022607412
Position
Unknown
AA seq 909 aa AA seqDB search
MQRSFTILYTSLLGMCLGSSSSFPSNINIGGLFPTESHEYEVFRFALSHHQDIPKLVPQV
DMVKMGNSFSMTYAFCSQFSKGVYAIIGLYDRKTVNMLMSFCGALHVCFVTPSFPIETAN
QFVIQLRPELQDALVGVIDHYGWTKFVYMYSSDSGLSVLQKVLDTAAERNWLVTSVNVET
MTEASFLKVFQDLDKRKEGQIIIDCETERLTGILKKIVEQGKNAKSYHYILANLGFLDID
LTDLRKGGANITGFQLVNNSEPGVSRVVQQWMEFDNKDSKVPKSGLKYTGALTYDGVKVM
STAFQNLRRQRIDISRRGNAGECLANPPAPWGQGIDIQRALQQVRIDGLTGHIQFNEKGR
RTNYTVSVMELAPSGPKKVGYWNEDEKYVTTASFMRGSNETYGLQNRTYIVTTILESPYV
MLKKNHEQLVGNDKYEGYIVELAAEIAKHVGYQYKLKIVSDGKYGARDPETKMWNGMVGE
LVYGKADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPTKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHAEDYEEGGEPQTPTQAAASNGMQQGQTPTQQNTN
PQSPEQTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLA
AFLTVERMVSPIESAEDLAKQTEIAYGTLDAGSTKEFFRRSKIAVFEKMWSYMKAADPSV
FVKTTDEGVMRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSP
LRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIG
GLGLAMLVALVEFCYKSRTESRRMKVSTARAAAASAAQAFHCSALDSGASAPYTELQSYG
LYANNTVKI
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcttcaccatcctctacaccagtttactggggatgtgcttgggttcaagc
tcaagttttccaagtaacatcaatataggaggattgttcccaaccgaatcgcacgaatat
gaggtttttcgattcgccctgtcgcaccaccaggacatccctaaactggtgccgcaggtg
gatatggtcaagatggggaatagcttctccatgacatatgccttttgctcccagttctcc
aaaggtgtgtacgccatcatcggtctgtatgacaggaagacagtcaacatgctcatgtcc
ttctgtggagcgctgcacgtctgcttcgtcacgccgtccttccccatcgagacggcaaac
cagtttgtcatccagctgaggcctgagctgcaggacgctctggtgggagtgatcgaccac
tacggatggaccaagtttgtctacatgtacagttctgattcaggcctgtcagtgctgcag
aaggtcctggacacagcagcagagaggaactggctggttacctcggttaatgtggagacc
atgacagaggcctctttcttgaaagtgttccaggatttggacaagaggaaggagggccag
attatcatcgactgtgagactgagaggctcactggcatcctcaaaaagattgttgaacaa
ggcaagaatgcaaagagctatcactacatcctggctaacctgggtttcctggacatcgac
ctgacagacttgaggaaaggtggggcgaacatcaccggcttccagctcgtcaacaactcg
gagcccggcgtcagccgcgtcgtccagcagtggatggagtttgacaacaaggactccaaa
gtgcccaagagtggactcaaatacacaggcgctttaacatatgacggggtgaaagtcatg
tccacggccttccagaatctaaggagacagaggatagacatttctcgcaggggcaacgcc
ggagagtgtcttgccaacccaccagctccctggggacagggcatagatatccagagagcc
ttgcagcaggtccgtatagatggattgactggtcacattcagttcaacgagaaaggccgc
agaaccaactacaccgtgagcgtcatggaactggccccatctggacctaagaaggtcggc
tactggaacgaagatgagaagtatgtgaccaccgccagcttcatgagaggcagcaacgag
acttacggcctgcagaacagaacgtacatagtcaccactatcttggagtctccgtatgtg
atgctgaagaagaaccatgagcagctcgtgggaaacgataagtacgagggctacatcgtc
gagttggctgcagagatagccaaacatgtgggctaccagtacaaactgaagattgtttca
gatggcaagtatggagccagggatcctgaaaccaagatgtggaacggcatggtgggcgaa
ctggtgtatgggaaagcagatgtggctgtggctcctctgaccatcaccctggtccgtgaa
gaagtcatcgacttctccaagcccttcatgtcccttggtatctccatcatgattaagaaa
cccaccaaatccaaacctggtgtgttttcattcctggacccactggcttacgagatctgg
atgtgcatagtgtttgcctacattggcgtcagcgtcgtcctcttccttgtcagtcggttc
agcccgtacgagtggcacgctgaggactacgaggagggaggtgagccacagactcccacc
caggctgcagcctctaacggaatgcagcagggccagacaccaactcagcagaacaccaac
ccacagagtcctgagcaaaccaatgagttcggcatcttcaactccctttggttttcactg
ggcgccttcatgcagcagggatgcgatatctcaccacgctctctgtctggccgtattgtt
ggaggcgtgtggtggttcttcacccttatcatcatctcctcctatactgccaacttggct
gccttcctgacagtggagaggatggtgtctcctatagagagtgctgaggatttggccaag
cagactgaaatcgcctatggaacgctggatgccggttccaccaaagagttcttcaggagg
tctaagatcgctgtgttcgagaagatgtggtcctacatgaaggcggctgacccatctgtg
tttgtcaagaccacggacgagggtgtaatgagagtcaggaagtccaagggcaagtatgcc
tacctgctggagtccactatgaacgagtacatagagcagaggaaaccctgcgacaccatg
aaggtgggagggaacctggactctaaaggttatggcatcgccacacccaagggctcccct
ctcagaaacccagtaaacctggcagtgttaaaactgaacgagcagggcctcttggacaaa
ttgaaaaacaagtggtggtacgacaagggagagtgcggcagcgggggcggggactccaag
gacaagacgagcgctctgagcctcagcaatgtggcaggagtcttctacatcctgatcggt
ggcctgggcctggccatgctggtggcgctggtggagttctgctacaagtccaggaccgag
tcgcgccgaatgaaggtgtccaccgcgcgagccgctgccgcctcagccgctcaggccttt
cactgctcagccttagacagtggtgctagcgccccctacacagagctgcagagctacggc
ctgtacgccaacaacactgttaagatataa

DBGET integrated database retrieval system