KEGG   Seriola dumerili (greater amberjack): 111227834Help
Entry
111227834         CDS       T05606                                 

Gene name
fbxl4
Definition
(RefSeq) F-box/LRR-repeat protein 4
  KO
K10270  F-box and leucine-rich repeat protein 4
Organism
sdu  Seriola dumerili (greater amberjack)
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sdu04121]
    111227834 (fbxl4)
   03029 Mitochondrial biogenesis [BR:sdu03029]
    111227834 (fbxl4)
Ubiquitin system [BR:sdu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     111227834 (fbxl4)
Mitochondrial biogenesis [BR:sdu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    111227834 (fbxl4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F-box F-box-like LRR_4 F-box_4 LRR_8 Adeno_E3_CR2 LRR_9
Motif
Other DBs
NCBI-GeneID: 111227834
NCBI-ProteinID: XP_022609280
Position
Unknown
AA seq 613 aa AA seqDB search
MLTLLSMFYYICLRRRSRSGTRGEALTSRRAVESGQRAVLPVSVEVEQYAKEVLDFSSHY
GSENSMSYTMWNLAGVPNVYPSSGDFTQTAVFRAYGTWWEQCASAPPPFRRTPKGFYSQD
YIELGFEEPVYPTTVEVLETYYPGAIVQILACSHNPFSQNPPTDVRWEVLWSGEPTKVLT
PQARQFSPNIKHISFPTNLLRLEVNSSLLDYYTELDAVILRGVKERPMLALYKMPVIDIS
DLSDSEEELSDLGGPFRQGGDGKHQRTGNGYFDKLPYELIQLILSHLTLPDLCRLAQSCK
LLHQHCCDPLQYTQLSLQPYWARLSDASLGHLQSRCTLLQRLNLSWTGNRSALTLTGFSS
FMKACGLSLVCLELSCCHFLNDACLEVISQTCPELQELNLSSCDRLHPQAFTHISKLTRL
RRLVLYRTKIEQTAILSILTFCIELRHLNLGSCVRIEDYDVVASMLAARCRSLCSVDLWR
CRNLTDRGLAELVSGCRMLEELDLGWCPTLQSSTGCFQHLARSLPRLRKLFLTANRTVCD
SDIEELAASCPSLQHLDILGTRLVSAASLKKLLQSCPRLLLLDVSFCSQIDMRVVQELCG
LFPNVAIKKSFTQ
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgttaaccctcttgagcatgttttactatatctgtctgcggcgacgctccaggagtggg
actcgaggcgaggctctgaccagtcgacgggccgtggagtcaggccaacgggcggtgttg
ccggtcagtgtggaggtggagcagtatgcaaaggaggttctggacttcagctcccactat
ggcagtgagaatagtatgtcctacaccatgtggaacctggctggggtgcccaacgtgtac
cccagttcaggagacttcacccagacagctgtattcagagcttatgggacatggtgggaa
cagtgtgccagcgctccaccacctttccgccgcacccctaaaggcttctatagccaggat
tatattgagctgggctttgaggagcctgtctatcctacaacagtggaagtgcttgagact
tattaccctggagccatcgtccagatcttggcctgctctcacaaccccttctcacagaac
ccacctactgatgtcagatgggaggtgctgtggtcaggggagcccaccaaggtgctgaca
ccccaggcacgccagttttcacccaacatcaagcacatcagcttccccaccaacctgctg
cgtctggaggtcaacagctccctgctggattactacaccgagctggatgctgtcattctc
cgcggggttaaagagaggcctatgctggccctttataagatgcctgtcatcgacattagt
gacctgagtgacagtgaggaggagctgtctgatttgggcggtcctttcaggcaaggagga
gatggcaagcaccagaggacaggaaatggctactttgacaagctgccctatgagctcatc
cagctgatactgagccacctgaccctgccagacctctgccgtctggcccagagctgtaag
ctgctgcaccagcactgctgcgacccgctgcagtacacccagctgagtctgcagccctac
tgggcccggctgagtgacgcttccttgggacacctgcagagccgctgcaccctcctccag
aggctcaacctgtcctggaccggcaaccgcagcgctctcaccctgaccggcttcagcagt
ttcatgaaggcttgtggtctcagcttggtctgtctagagctgtcatgctgccatttcctg
aatgacgcctgtctggaggtcatctcccagacttgtccagagctgcaagagctcaacctg
tcctcctgcgaccgcctccacccgcaggccttcactcacatctctaaactaacccgcctc
cgcaggctcgtgctctataggaccaagatagagcaaacagctattctgagcatcttgact
ttctgcatagagctcagacacctcaacctaggaagctgtgtgaggattgaggactatgac
gttgtggccagtatgctagctgctcgctgtcgctcactctgctcagtggacctgtggcgc
tgcagaaacctgacagatcgcggcctggccgagctcgtctctggctgcaggatgctggag
gagttagacctgggctggtgtcccacactgcagagcagtactggatgtttccagcacctt
gcccgcagcctgccacgcctgcgcaaactcttcctcaccgccaaccgcaccgtctgcgac
tcagacatagaggagctggccgccagctgcccctcactgcagcacctcgacatactgggt
acacggttggtgagtgctgcctcgctgaagaaactcctccagtcgtgtcctcgacttctc
ctcctggacgtctccttctgctcccagatagacatgcgggttgtccaagagctctgtggc
ctcttccccaatgttgccatcaagaagagtttcactcagtga

DBGET integrated database retrieval system