KEGG   Seriola dumerili (greater amberjack): 111227872Help
Entry
111227872         CDS       T05606                                 

Gene name
tgfb2
Definition
(RefSeq) transforming growth factor beta-2
  KO
K13376  transforming growth factor beta-2
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04010  MAPK signaling pathway
sdu04060  Cytokine-cytokine receptor interaction
sdu04068  FoxO signaling pathway
sdu04110  Cell cycle
sdu04218  Cellular senescence
sdu04350  TGF-beta signaling pathway
sdu04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111227872 (tgfb2)
   04350 TGF-beta signaling pathway
    111227872 (tgfb2)
   04068 FoxO signaling pathway
    111227872 (tgfb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111227872 (tgfb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111227872 (tgfb2)
   04218 Cellular senescence
    111227872 (tgfb2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111227872 (tgfb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sdu04052]
    111227872 (tgfb2)
   00536 Glycosaminoglycan binding proteins [BR:sdu00536]
    111227872 (tgfb2)
Cytokines and growth factors [BR:sdu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   111227872 (tgfb2)
Glycosaminoglycan binding proteins [BR:sdu00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   111227872 (tgfb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Motif
Other DBs
NCBI-GeneID: 111227872
NCBI-ProteinID: XP_022609320
Position
Unknown
AA seq 421 aa AA seqDB search
MNLCVVGLLLALDLATVALSLSTCSTLDMDQFKKKRIEAIRGQILSKLKLTSPPEDFPEP
EEVSRDIVAIYNSTRDLLQEKANERAATCERQRSEEEYYAKEVHKIDMQPFYPSENVISP
THFNPYFRRLTFDVSSMEKNASNLVKAELRIFRLQNPGARVSEQRIELYQILGHKDLTSP
TQRYIDSKVVRTQTEGEWLSFDVTEAVSEWLNHRDRNSGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDDSFIHGGDLKVFKRRRHSARAPHLLLMLLPSYRLESQSQSQSQSQA
QHKNHRSKRALDAAYCSKNVQDNCCLRSLYIDFKKDLGWRWIHEPKGYDANFCAGACPYL
WSADTQHSKVLGLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMKVKSCKC
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgtgtgtcgtcggtcttctcctcgcgctggatttagccaccgtggcgctcagc
ctgtccacatgcagcacgctggacatggatcagttcaagaagaagcgcatcgaggccatc
cgagggcagatcttgagcaagctcaagctcaccagccccccggaggacttccccgagccc
gaggaggtgtcccgggacatagtggccatatacaacagcacgcgggacctgctgcaggag
aaagcgaacgaacgcgcggcgacgtgcgagcggcagcgcagcgaggaggagtattacgcc
aaggaggtacacaagatcgacatgcagcccttctacccgtcagagaacgtcatctctccg
acacacttcaacccttacttcaggcggctgacgtttgacgtgtcgtccatggagaagaat
gcgtcgaacctggtgaaggctgagctcaggatcttccgtctccagaaccccggagcccga
gtgtccgagcagcgcatcgagctctaccagattttaggacacaaagacctgacgtccccg
acacagcggtatatcgacagcaaggtggtacgaacacagacggagggagagtggctgtcg
tttgacgtcacagaggcagtgagcgagtggctgaaccacagagacagaaacagtggattc
aagatcagcctgcactgcccctgctgcacgtttgtaccgtcaaataactacattattccc
aacaagagcgaggagctggaggcgcggttcgcaggtattgacgacagcttcatccacggc
ggcgacctgaaggtgtttaagaggcggcggcacagtgctcgggctccgcaccttctgctc
atgctgctgccttcatacaggctggagtcccagtcccagtcccagtcccagtcccaggcc
cagcacaagaaccatcgatccaagagagccctggatgctgcctactgctccaaaaatgtt
caggacaactgctgcttacggtcgctctacattgacttcaagaaggacctgggctggagg
tggatccacgagccaaagggatatgacgccaacttctgtgccggggcgtgtccgtatctg
tggagcgccgacacccagcattccaaggtgttaggcctttacaacaccatcaaccctgaa
gcatcagcatcaccctgctgcgtctcccaggacctggagcccctcaccatcctctactac
attggcaagacccccaagatagagcagctctccaacatgaaggtcaagtcctgcaagtgc
agctag

DBGET integrated database retrieval system