KEGG   Seriola dumerili (greater amberjack): 111228239
Entry
111228239         CDS       T05606                                 

Gene name
ahrr
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
sdu  Seriola dumerili (greater amberjack)
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sdu03000]
    111228239 (ahrr)
Transcription factors [BR:sdu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    111228239 (ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 111228239
NCBI-ProteinID: XP_022609799
Position
Unknown
AA seq 697 aa
MIPPGDCMYAGRKRRKPIQKQKPSAANEKTNPSKRHRDRLNAELDRLASLLPFPPDVISK
LDKLSVLRLAVSYLRVKSFFQASQDKTSRKHIIGTASTNPEPRKESLPLGNTVNESSLLL
ESLTGFALVVSSDGMVFYASSTIVDYLGFHQTDVMHQNVFDYIHIDDRQEFRRQLHWAMC
PPQHQGTSAHQDNQLPAGTGEDFVVSSQFHSLEAGGIPPELSCFLNRCFIARVRCLLDST
SGFLTMQFQGRLKFLHGQKKKSASGALLPPQLALFCVAVPLLLPSITEMKMKNMLMRGKN
KGGAGGGGIISALEHGERGEHLRRHSFSGGMGDIADPLLLSCPTPGGTQRGHHTPWTPLS
KDNLKYRPDGYYNQEEPLNYCKSSMASHKGLSPGLGGGWPLRPNSGPLRAGQGMGYIPSN
RVNKAGQYGKPYRLSPNYHSSRGGEVFVSKLYGNIQIPTDPDAYCVDLVKSENGYGECYD
GHLMPEMPPIKVEHDSDSENGCDAYGRPWACRDPEAIDRRYGNGIYDQSSGLQLKSEADY
YDPQYSPCQRGKAGISPPYNNGNYHNYAVNNSGNTAARLLKCDKDMGNNNDNNQFSPQRL
SHSDSLCSNQSVNLMDSHVYPQDPHKAYMQPDYNKHGTYEFKGHGLIHSIKREPMDSPPW
SESGHDINQSMMVGPRNVMPCVMSTGHHKSSPYIYMQ
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgatccctccgggagactgcatgtatgcgggcagaaagcggaggaagcccatccaaaaa
cagaagccgtccgctgccaatgagaaaaccaacccgtccaagcggcaccgggacaggctg
aacgctgagctggaccggctggccagcctgctgccgttccccccggatgtcatctccaag
ctggacaagctgtccgtgctgcgccttgcagtttcctacctccgtgtcaaaagcttcttc
caagcaagccaagataagacctccaggaagcatatcatcggcacagcatccactaaccct
gaacccaggaaagagagtcttccactgggcaacactgtcaatgaaagcagcctcctcctg
gaatctctgacaggctttgccttggtggtgagcagtgatgggatggtcttttatgcctcc
tcgaccattgtggattatctgggatttcatcagactgacgtgatgcaccagaatgtgttt
gactacatccacatagacgaccgtcaggagttcagacgccagctccactgggccatgtgt
cctccacagcaccagggaacatctgcccaccaggataaccagttacctgcagggactggt
gaggactttgtagtcagcagccagtttcactctctggaggcagggggaattcctcctgag
ctctcctgctttcttaacagatgtttcatagccagagtccgatgcctcttggacagcacc
tctggattcttgactatgcagttccagggtcgactgaagttcctccatgggcagaagaag
aagtcagcctctggggctctgctgcctccccagctggcactgttctgtgtagctgtaccc
ctcctactgccctccatcactgagatgaaaatgaagaacatgctaatgcggggaaagaac
aagggaggagcaggaggaggagggattatctctgcactggagcatggtgagcgaggggaa
caccttcggaggcactccttcagtgggggaatgggtgacatagcagaccctctcctcctc
tcatgtcccactcctggtggtacccagcgaggtcaccacactccctggaccccgctctcc
aaagataacctcaagtaccgccctgatggatactacaaccaggaggagcccctaaactac
tgtaagtcctccatggcttcccataaaggcctcagcccaggcctgggtggcggctggccc
ctgcggccaaactcaggtcccctcagagcgggccagggtatgggctacatcccctctaac
cgcgtgaacaaggccggtcagtacgggaagccataccgcctttccccgaactaccacagc
agcagaggtggcgaggtgtttgtgtctaagctctatgggaacatccagattccaacagac
ccagatgcgtactgcgtggacctggtgaagagcgagaacggctatggagaatgctatgat
ggccatctaatgcccgagatgccccccatcaaggtagagcatgactcagactctgaaaac
ggctgcgatgcctatgggcgaccctgggcttgccgcgacccagaggccatcgaccgtcgc
tatggtaatgggatatacgaccaaagctccggcctgcagctgaaatcagaggcagattat
tatgatccgcagtactcgccctgtcagcgagggaaagcaggcatcagcccaccgtacaac
aacggcaactatcacaactatgcagtcaacaacagcgggaatacggccgcacgtctgtta
aagtgcgacaaagacatgggaaataacaatgacaacaaccagttcagtcctcagagactc
tcccattcagactctctatgcagcaaccaatctgtcaacctcatggactcacacgtctac
ccacaggaccctcacaaggcctacatgcagccggactacaacaagcatggcacttatgag
ttcaaaggtcatggcctgatccattcaatcaaacgggagcccatggactccccaccgtgg
tctgagagcggtcatgacataaaccagtccatgatggttgggccaaggaacgttatgcca
tgtgtgatgagcacaggccaccacaagtccagtccttacatttatatgcagtaa

DBGET integrated database retrieval system