KEGG   Seriola dumerili (greater amberjack): 111228618Help
Entry
111228618         CDS       T05606                                 

Gene name
sephs1
Definition
(RefSeq) selenide, water dikinase 1
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00450  Selenocompound metabolism
sdu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    111228618 (sephs1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sdu03016]
    111228618 (sephs1)
Enzymes [BR:sdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     111228618 (sephs1)
Transfer RNA biogenesis [BR:sdu03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    111228618 (sephs1)
 Prokaryotic type
    111228618 (sephs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-GeneID: 111228618
NCBI-ProteinID: XP_022610329
Position
Unknown
AA seq 392 aa AA seqDB search
MSVRESFNPESYELDKNFRLTRFAELKGTGCKVPQDVLQKLLETLQENHYQEDEQFLGAV
MPRLGIGMDTCVIPLRHGGLSLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECD
NMLMLLGVSNKMSEKERDKVMPLIIQGFKDASEEAGTSVTGGQTVLNPWVVMGGVATTVC
QPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYHEA
MMNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQTLARQQRSEVSFVIHNLPVLAKMA
AVSKACGNMFGLMHGTCPETSGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKG
NRTARIIDKPRIIEVAPQAATQNVNPTPGATS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgagggagtcctttaaccccgaaagctatgagctggacaagaacttcaggctc
acacgctttgctgagctcaagggcacaggctgcaaggtgccgcaagatgtgttacagaag
ctgctagaaaccctacaggagaaccactatcaagaagatgaacagttcctgggggcagtt
atgcctcgattaggcataggtatggacacctgtgtgatacctctcagacatggaggcctt
tctctggtccagactacagattacatctatcctattgtggatgacccctacatgatgggg
agaattgcttgtgccaatgttctaagtgacctgtacgccatgggagtgacagagtgtgac
aacatgttgatgctcctgggagtcagcaacaaaatgtcagagaaggagagagacaaagtc
atgccactgatcatccagggattcaaggatgcttcagaggaggcaggcacatctgtaaca
ggaggacagacggtgctcaacccctgggtggtgatgggaggagttgctacaacagtctgc
cagcctaacgaatttatcatgccagacaatgcagtgccaggagacgtgttggtgttgacc
aagccacttggaacgcaagtggccgttgcagtacaccagtggctagatattcctgagaag
tggaacaagatcaagctggtggtaacccaggaagatgtagagctggcctaccatgaagcc
atgatgaacatggctcggctcaacaggacagcggctggtctcatgcacaccttcaatgcc
cacgcagccaccgacatcacaggttttggcatccttggccatgctcagacattggcacga
caacaacgaagtgaagtgtcatttgtcatccacaacctcccagtgctggccaagatggct
gcagtgtccaaggcctgtgggaacatgtttggtctcatgcacggcacctgtcctgaaaca
tcaggaggcctgcttatctgtctgccccgggagcaggctgcccgcttctgtgccgagatc
aaatctccaaaatatggagagggccaccaagcgtggatcatcgggatcgtagagaaagga
aaccgcactgctcgcatcattgacaaacctcggatcatagaggtagcaccacaagctgcc
acgcagaatgtcaacccaactcctggtgcaacctcttaa

DBGET integrated database retrieval system