KEGG   Seriola dumerili (greater amberjack): 111228945Help
Entry
111228945         CDS       T05606                                 

Definition
(RefSeq) aldehyde dehydrogenase family 9 member A1-B-like isoform X1
  KO
K00149  aldehyde dehydrogenase family 9 member A1 [EC:1.2.1.47 1.2.1.3]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00010  Glycolysis / Gluconeogenesis
sdu00053  Ascorbate and aldarate metabolism
sdu00071  Fatty acid degradation
sdu00280  Valine, leucine and isoleucine degradation
sdu00310  Lysine degradation
sdu00330  Arginine and proline metabolism
sdu00340  Histidine metabolism
sdu00380  Tryptophan metabolism
sdu00410  beta-Alanine metabolism
sdu00561  Glycerolipid metabolism
sdu00620  Pyruvate metabolism
sdu01100  Metabolic pathways
Module
sdu_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111228945
   00053 Ascorbate and aldarate metabolism
    111228945
   00620 Pyruvate metabolism
    111228945
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111228945
   00561 Glycerolipid metabolism
    111228945
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    111228945
   00310 Lysine degradation
    111228945
   00330 Arginine and proline metabolism
    111228945
   00340 Histidine metabolism
    111228945
   00380 Tryptophan metabolism
    111228945
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111228945
Enzymes [BR:sdu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     111228945
    1.2.1.47  4-trimethylammoniobutyraldehyde dehydrogenase
     111228945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 111228945
NCBI-ProteinID: XP_022610784
Position
Unknown
AA seq 517 aa AA seqDB search
MLQRLALSLRRPHAAPLAPGLRFVSSGSVNVTVPLNFWAGKRRTSQHKCNKEIVYEPATG
RVLCHLEPCGALDVDQAMKAAKSAFGHWSKMSGMERARIMIEAAHIIESRREEIAEMEVV
NNGKSITEARLDVDSGRLCIEYYAGLASTLAGQHVQLPGGSFAYTRREPLGVCVGIGAWN
YPFQIAAWKSAPALACGNSMVFKPSPVTPVTAVMLAEIYAKAGAPEGLFNVVQGSQDTGS
LLCHHPDVAKVSFTGSVPTGKKIMEMASRGVKPVTLELGGKSPLLIFQDSDLENAVRGAL
MANFLSQGQVCSNGTRVFVQKDILPEFVEEVVKRTQAIEIGDPLLESTRMGALVSKPHLE
KVLSFVDQAKKEGATVLCGGELFTPSDPKLKGGYYMTPCVLGDCTDDMTCVKEEIFGPVM
SVLSFETEEEVLYRANNTTMGLAAGVFTRDVRRAHRVVENLKAGSCFINNYNITPVEVPF
GGFKMSGIGRENGQVTIEHYSQLKTVFVEMGDVDSLF
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctccagaggctcgctctgtccctgcggcggccccatgccgctcctctcgcgcccggg
ttaaggtttgtctcctcgggctcagtgaacgtcaccgtcccgctaaacttctgggctggg
aagagaaggacgagccaacacaaatgcaacaaggaaattgtttatgaacctgcaacaggg
cgagtcttgtgccatttggagccgtgtggtgctttggatgtcgatcaggctatgaaggcc
gcaaagtcggcctttggccattggagcaagatgtctgggatggagagggcaaggatcatg
atagaagctgcccatatcattgagagcaggagagaggagatagctgaaatggaggtggtc
aacaatgggaagtccatcacagaggcccgtctggatgtggactctggcagactgtgtata
gagtactatgcaggactggccagcactctggcaggccagcatgtgcagctgcctggagga
tcctttgcctacacccgcagggagcctttgggagtctgtgttggaattggtgcttggaat
tatccttttcagattgctgcctggaaatcagctccagccctggcctgtggcaactccatg
gtgttcaagccgtcaccagtgacacctgtgacggcagtcatgctggcagagatctatgct
aaggctggagctccagaggggctgttcaacgtggtgcagggcagccaggacaccgggagc
ttactctgccaccaccccgatgtggctaaggtctccttcactgggagtgtgcccacagga
aagaagataatggagatggcatccagaggggtgaaacccgtgactctggagcttgggggg
aaatctcctctgctcatcttccaggacagtgatctggagaacgctgtgaggggagctctc
atggccaatttcctttctcagggacaggtctgcagcaacggcacaagggtctttgttcag
aaggatattctgcctgagttcgtggaggaggtggtgaagaggacccaggcgatagagata
ggggacccgctgttagagagcacccgaatgggagcactggtcagcaagccacatctagaa
aaagtcctgtcctttgtggatcaggcaaagaaagagggagccacagtgttgtgtggaggt
gaactttttaccccatcagaccccaaactcaaaggtggatactacatgactccatgtgtg
ttgggtgactgcacagatgacatgacctgtgtgaaggaggagatctttggtcccgtcatg
tctgttttgtcctttgaaacagaagaggaagtgctgtatagagccaacaacaccaccatg
ggtctggctgcaggagttttcaccagggatgtgaggcgagcccatcgtgtggttgaaaac
ctcaaggctggttcctgtttcattaacaactacaacatcactcccgtcgaggttcccttc
ggaggcttcaaaatgtcaggcatagggcgggagaatggccaggtgaccatcgaacactac
tcccagctaaagacggtgtttgtggagatgggcgatgtggacagtctcttctag

DBGET integrated database retrieval system