KEGG   Seriola dumerili (greater amberjack): 111229760Help
Entry
111229760         CDS       T05606                                 

Gene name
pik3c2g
Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00562  Inositol phosphate metabolism
sdu01100  Metabolic pathways
sdu04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    111229760 (pik3c2g)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    111229760 (pik3c2g)
Enzymes [BR:sdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     111229760 (pik3c2g)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka C2 PI3K_C2 PI3K_rbd PX DUF4135 Transposase_21 DUF3136
Motif
Other DBs
NCBI-GeneID: 111229760
NCBI-ProteinID: XP_022611951
Position
Unknown
AA seq 1393 aa AA seqDB search
MDPPERRNGTIQRQNASDTDFPMPLREDLHGTHIYEYIEVFPENDETHLYECTLSGLLSP
TEPQPQPQGHLWAQGRGGTGNTDHQGTNGPLPVRAPPPPPRTRLPSACLPGKSGRKAPPV
PPRTRVPLCNSKKQFSSGLTEPAHKLNRSRTEIDNHEPWTVNLIDTPQGSTKRLASFCDA
TSRLMSQHKHTDSVHNSGVVWGRLLQIHPALLQQVEVTVSVATEWENQQVPFPTPVNRTV
KSLIDQIFQLLDLPPRTSGHYLLKLCDSEEYLRNDELLGMHETIQIYNKFQVVVPLRLLH
VDNLKYRLARDGADDRTPCLVYKFLRPACVFDTCKLSLQDVLSSLNREVTEVMKSKSGMN
VKVLVDHVRTVSSLLCGFSCQELEDAISRLNRLNPMPLSHEEIFECESAIIMLHGALLKV
LQIFFDNFQSDFRGQEVTCNPQTHDVEENTEICQFNVAALYNLQLSWLTVYEYFSVSCEL
TYGGTRLCDTGVSENISTALSYGNKIQCNRMMVFPVPVKELPYESMLTFHLKGSKKGKSP
ELLGWAVLPLYSNRTLVAGTVLLSLSTLAVSPAPPSPALFDSHTQPIGVIMQLEFQNEYK
WTYQRPIALTGSVVFSQACEELQKKMLDVSKKHCICFLTENEKTFLWEKRHCGDKGCTFL
HLMLGGVQLWQPEYLTEIYTVVENWLMYLPEEALFLLSDSFHDQTVRRAAVQFFEQIPDE
DLEVYLPQLVQALKSEWELDGPLVMLLLERSMRNIRLAQQLFWLLEDAHSDPYYQSWYSK
IKAVLRHCCGRTLRQELEHETRLVSVLVQVAENVRTADKARRKNVLNKEKQKIDDFFKDG
ISCCLPLDPAVRVKAVALDACKFYNSNAAPLGITFISTDPLSKNVSVICKTGDNLRQDML
VLQIVRVMDRVWLQEGLDLRMVTYRCLSTGKAQGLVEVVPEAVTLGKIQQEWGLGGTLRE
DTLEKWFHMWNKTKEDYEKAVMNFIHSCAGWCVATFILGICDRHNDNIMLKHSGHMFHID
FGKIMGNAQKFGNFKRDRSPFIFTSEMQHFITGGGQKPQWLHRFVELCCEAYNIIRGRSA
LILSLLELMLHAGMPELKDSNDLQYVQNNLRPHDTDLEATSYFTKKIKESMGCVAVKFNF
LTHSMAQGKKQESRAREGIPSPSNNIQEAVIQGYTVKGKDVIYALRVTIHDGYLTSEKTF
GQFELIHKQLQKYFIESMLPQFPSWYKMSFTPARKMSLLNKYLKQLFEGPCKGNEYVCSL
FLDGPSIVQEGVATGARPQIQLYISYANSKLSVLVKHLKNVKQANGSNPDAYVVTRLRPD
PHQRSKRKTKVVRNNDNPTFNELLEYNSVSLLYGMVLEVTVKSKKTFVAATNIKLDDKLL
DTETWFPLGNCAI
NT seq 4182 nt NT seq  +upstreamnt  +downstreamnt
atggatcctcctgaaaggcgaaatggaacaatccagagacaaaacgcaagtgacactgac
ttccccatgcctctgagagaggatcttcacggaacacacatttacgagtacattgaggtc
tttcctgaaaatgatgaaacacatttgtatgagtgcaccttgtctgggctcctatcccca
actgaaccacaaccacaaccccaaggccatctctgggctcaaggcagaggaggtacaggg
aatactgaccaccaaggcacaaatgggcctcttccagtccgtgcccctccccctccaccc
agaaccaggcttccaagtgcatgtttgccaggtaaatcaggccgtaaagccccccctgtt
ccccccagaacacgagtacccctctgcaacagcaaaaagcagttttcctctggcctcact
gagcctgctcacaaactgaaccgttccaggacagaaatagacaatcatgagccatggacc
gtgaatctaatagacactccacaaggcagcaccaagaggctcgcttctttttgtgacgca
acttccaggctgatgtcgcagcacaaacacacagacagtgttcataactcaggtgtggta
tggggtcgattgttacaaattcaccctgcgctgctgcagcaggtggaggtgactgtcagt
gtggccactgagtgggagaatcagcaggtccccttccccacccccgtgaacaggacagtg
aagagtctgattgatcaaatcttccagctgctggatctccctcccagaacaagtggccat
tatcttctaaaactttgcgactctgaagaatacctccgaaatgatgaactgctgggtatg
catgagactattcagatctacaacaagtttcaagtagtagtccccctccgactgctccat
gtcgacaacctcaaatatcgtctggccagggatggcgcagacgacaggaccccgtgccta
gtgtacaagttcctgcgtcctgcctgtgtcttcgacacctgcaagttgagcctgcaggat
gtgctcagtagtttgaacagagaggtgacagaggttatgaaaagtaagtctgggatgaac
gttaaagtgcttgtggatcatgttcgcaccgtcagcagtctactgtgtgggttctcatgt
caggagttggaggacgccatcagtcgcctcaacagactcaaccccatgcctttgagtcat
gaggaaatatttgagtgtgaaagtgcgataatcatgctccatggggcgctgctcaaagtg
ctgcagatcttttttgacaacttccagtcagacttcagaggtcaggaggtaacatgcaac
ccgcaaacacatgacgttgaggaaaacactgaaatctgccaattcaacgttgctgccctc
tacaatctgcaactcagctggctgaccgtttatgagtatttctctgtttcctgtgagttg
acgtacggaggaacgaggctctgcgacacgggtgtttctgaaaatatcagcaccgcgctg
tcatatggaaacaagatccagtgtaaccgcatgatggtcttcccggttccagtgaaagag
ctgccatatgagagcatgttgacatttcacctcaaaggctctaagaaaggaaagagccca
gagcttttaggctgggccgtactacctctttacagcaaccgcactcttgtagcagggacc
gtcctgctcagtctgtccacactggcggtgtcgcctgctcctccctcccctgccctgttt
gacagccacacacaacccattggagtcataatgcagcttgagtttcaaaatgagtataag
tggacgtaccagaggcccatcgcactcaccggttcagtcgtattctctcaggcttgtgag
gaattgcaaaagaaaatgctggacgtctctaagaagcactgcatctgctttctaacagaa
aatgagaagactttcctctgggagaagcgtcactgtggtgacaaaggatgtactttcctc
cacctgatgctgggtggagtccaactgtggcaacctgaatacttgacagaaatctataca
gtcgtagagaactggctcatgtatctgccggaggaggccctcttcctgctgagtgacagt
tttcatgatcagactgtgcggcgtgctgcagttcaattctttgaacagatcccagatgaa
gacctggaggtgtatctgccacagctggtccaggctctgaagagtgagtgggagctggat
ggacctctggtgatgctgctgttggagagatcaatgaggaacataagattagcccagcaa
ctcttctggctgctggaggatgcccacagcgacccctattaccagagttggtacagtaag
attaaggctgttctgcgacactgttgtggccggacactgaggcaggagcttgagcatgaa
acccgactggtgtccgtgcttgtacaggtggctgagaatgtccgcaccgccgacaaggct
cgacgtaagaatgtgttgaacaaagaaaagcagaagatcgatgacttcttcaaagatggg
atcagctgctgtctcccactggatcctgcagtccgtgttaaggcagtggccttggatgct
tgtaagttctacaactctaatgctgctcctctggggatcacgttcatcagtactgaccct
ctgtctaagaacgtcagtgtcatctgcaagacaggagataacctgcgtcaggacatgctg
gtacttcagatagtccgtgtgatggacagggtgtggctgcaggaggggctggacctccga
atggtcacctacaggtgtctttctacaggcaaagctcagggtctggtggaagtggttcca
gaggcagtgaccctggggaagattcagcaggagtggggtctgggtgggacccttcgtgag
gacacactggagaaatggttccatatgtggaataaaactaaggaggactatgagaaggct
gtgatgaacttcatccactcgtgcgcagggtggtgcgtggccacgttcatcctggggatc
tgtgaccgccacaacgacaacatcatgttgaaacacagtggacacatgttccacattgac
tttggcaaaattatgggcaatgcacagaagtttggaaactttaaaagggaccggtcacca
ttcatctttacatctgagatgcagcacttcatcacaggtggggggcagaagcctcagtgg
ttgcatcgctttgtggagctctgctgtgaagcttacaacataatcagggggcgctctgca
ctgatactcagcttattggagctgatgctgcacgcaggtatgccagaactgaaggactct
aatgacctgcagtatgttcagaacaacctcagacctcatgacactgacctggaggccaca
tcgtactttacaaagaagatcaaagagagcatgggctgtgttgcagtgaagtttaacttc
ctgacacacagcatggctcaagggaagaaacaagaatcaagagccagggagggcatccct
agtcccagcaacaacatccaagaagctgttatccagggatacaccgtcaagggaaaagat
gtgatctatgccctgagagtaaccattcacgatggttatctgaccagtgagaagacattc
gggcagtttgagctgatccataagcagctgcagaaatacttcattgaatccatgctgcct
cagtttcctagctggtataagatgtcattcactccagccaggaagatgtctctgctgaat
aaatacctaaaacagctttttgagggaccatgcaagggaaatgaatatgtctgcagcttg
ttcctggatggccccagcatagtccaagaaggtgtggcgacaggagcccgtcctcagatc
cagctgtacatttcttacgctaactctaagctctcggtcttggtaaaacacctgaagaac
gttaagcaggcaaacggctctaaccctgacgcctatgtggtcacgcgtctgagaccggac
cctcaccagcgctccaagaggaagacaaaggtggtccgcaataatgacaaccccactttc
aatgaactgctggagtataattctgtctcactgctctatgggatggtgctggaagtgaca
gtgaagagcaagaagacttttgtggctgcaaccaacattaaactggatgacaagctgctt
gacacggaaacatggtttcccctggggaactgtgcaatctga

DBGET integrated database retrieval system