KEGG   Seriola dumerili (greater amberjack): 111230530Help
Entry
111230530         CDS       T05606                                 

Definition
(RefSeq) septin-7-like isoform X1
  KO
K16944  septin 7
Organism
sdu  Seriola dumerili (greater amberjack)
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sdu04131]
    111230530
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sdu04812]
    111230530
   04147 Exosome [BR:sdu04147]
    111230530
Membrane trafficking [BR:sdu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    111230530
Cytoskeleton proteins [BR:sdu04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     111230530
Exosome [BR:sdu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111230530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 AAA_22 Ras AAA_16 FeoB_N ABC_tran AAA_29 Roc Gtr1_RagA Tweety APC_u14
Motif
Other DBs
NCBI-GeneID: 111230530
NCBI-ProteinID: XP_022613009
Position
Unknown
AA seq 442 aa AA seqDB search
MPSGETLVGEADGNGGIMAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGK
STLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLVKEGGVHLLLTIVDTPGFGDAVDN
SNCWQPVTDYIDSKFEDYLNAESRVNRRQMPDSRVQCCLYFIAPSGHGLKPLDIEFMKRL
HEKVNVIPLIAKADTMTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEEMKMIRKIKDR
LPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNN
VHYENYRSKKLAAVTYNGVDNNKSKGQLTKPETSDGMSPLAQMEEERRDHVSKMKKMEQE
MEQVFEMKVKEKLQKLRDSEAELQRRHEQMKKNLEAQHKELEEKRRQHEEEKAGWEAQQR
ILEQQKLDASRTLEKNKKKKIF
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgccaagcggagaaacattggttggagaggcagacggaaacggcggcataatggctcaa
cagaagaacctggagggctatgtgggctttgcaaatctacccaaccaagtttacagaaaa
tcagtgaagagaggttttgagttcacactcatggttgtaggggaatctgggctggggaag
tcgacgctgatcaactcgctctttctgacggacctctactcccccgagtacccgggtcct
tcgcacagaataaaaaaaactgtacaggtggaacagtcgaaggttcttgtaaaggaagga
ggagtccatcttctgctcaccatcgtcgacacccccgggtttggtgatgctgttgacaac
agtaactgctggcagccagtcaccgattacatcgacagcaagtttgaagattacctcaac
gcagagtctcgggtcaacagacgacagatgccagacagcagagtgcagtgctgcctgtac
ttcattgccccgtctggacatggactgaagcccctcgatattgaattcatgaagcggtta
cacgaaaaagtaaacgtcattcccctaatcgccaaagccgacacaatgactcccgaggag
tgtcaacagttcaagaaacagatcatgaaagaaatccaggagcacaaaatcaaaatctac
gagttcccagagacggatgatgaggaggagatgaagatgatcaggaaaatcaaggatcgt
ttacccttggccgtagtcggtagtaacaccatcatcgaggtcaatggaaagcgagtgcgc
gggaggcagtacccgtggggcgtggctgaagtggaaaacggagagcactgtgatttcaca
attctccggaacatgctcatcaggacccacatgcaggacctgaaggacgtgaccaacaac
gttcactatgaaaactaccgcagcaagaaactagccgccgtcacctacaacggtgtggac
aacaacaagagcaagggtcagctgaccaaacctgagacgtctgacggcatgagtcctcta
gcccagatggaggaggagcgccgggatcacgtgtccaagatgaagaagatggaacaagaa
atggagcaagtgtttgagatgaaggtcaaagagaagctccaaaagctcagagactcggag
gctgagctccagaggcgtcacgagcaaatgaaaaagaacctggaggcccagcacaaagaa
ctggaggagaaacgtcgccaacacgaggaggagaaggccggctgggaggctcagcagagg
atcctggagcagcagaagctcgacgcctccagaaccttggaaaagaacaagaagaagaag
atattttaa

DBGET integrated database retrieval system