KEGG   Seriola dumerili (greater amberjack): 111231038Help
Entry
111231038         CDS       T05606                                 

Gene name
rock1
Definition
(RefSeq) rho-associated protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04270  Vascular smooth muscle contraction
sdu04350  TGF-beta signaling pathway
sdu04510  Focal adhesion
sdu04530  Tight junction
sdu04810  Regulation of actin cytoskeleton
sdu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    111231038 (rock1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111231038 (rock1)
   04530 Tight junction
    111231038 (rock1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111231038 (rock1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111231038 (rock1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111231038 (rock1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sdu01001]
    111231038 (rock1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sdu03036]
    111231038 (rock1)
Enzymes [BR:sdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111231038 (rock1)
Protein kinases [BR:sdu01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   111231038 (rock1)
Chromosome and associated proteins [BR:sdu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    111231038 (rock1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH HR1 C1_1 Pkinase_C DUF3153 Filament APH PRANC
Motif
Other DBs
NCBI-GeneID: 111231038
NCBI-ProteinID: XP_022613714
Position
Unknown
AA seq 1364 aa AA seqDB search
MSAGQSMEARFEKIDAMLKDPKSEVNTDCLLDGLDALVYDLDFPALRKNKSIDNFLNRYK
ETISKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHRATCKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSSWVVQLFFAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDGIHSMGFIHRDVKPDNMLLDKAGHLKLADFGTCMKMNKDGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNALTFP
EDSDISNDAKNLICAFLTDREVRLGRNGVDEIKRHPFFKNDQWTWENIRETAAPVVPELS
SDIDTSNFDDIEEDRGEEETFPIPKAFVGNQLPFVGFTYYSNQHLLRSSTTTKTSDKRSS
STKEDKSHLENLQKRIYHLEEQLHGEMQLKDELEQKCRTSNTKIDKIMKELDEEANLRKS
AEASVSLLEKDKIMLQHRFTEYQRKADQEAEKRRNLENEVSTLKEQLEDMRKISQNSQAS
NDKIAQLQNQLEEANDLLRAESDTAARLRKSHTEMAKSMSQLESLNRELQERSRAADGEK
AQLEKDLLLVQSTLDSERRNYSQGSEEIRELQARMAGLQEDNKNLKLSLSKVEAERKQAQ
ERSNNLEKEKNNLEIDLNYKLKTLQQRLEQEQTEHRVTRAQLTDKYESIEEAKSAAMNAV
QQKMSEENGARMRAESRVVEVEKQCSMLEFDLKQSVQKMEQLMKQKERLEDEVKNLRIQV
EQESSKRVLAQNDLKSRTQEVDRLRCSEKQLKQEINTALESKRSLEFQLAQLTKQYRGNE
GQMRELQDQLEAEQYFSTLYKTQVKELKEEIEERNRQVQEANKKVHELCSERDSLSAQLD
LTVTKAESEQLARALQEEQYFELSQESKKAVTRHKQEIGEKEATIARLEESNKTLTKDVE
NLSKEKSDLNEKLHIQDEEYAAQKEEIANTIKATYEKVLNNERTLKTQAVNKLAEIMNRK
DMKLDQKKKGSTADLRKKEKENRKLQLELNQEKEKFNHMAIKYQKELSEMQAQLAEECTY
RNELQMQLDSKESDIEQLREKLNDLQQRMDNSSVTSLQTDETDSNIAESRLEGWLSIPNR
ANIKRYGWKKQYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETE
EIPRIFQILYANEGECRKEADMETVPQGDKTNCLPHKGHEFIPTLYHFPSNCEACAKPLW
HVFKPPPALECRRCHVKCHKDHLDKKEDVIAPCKVNYDVTSARDMLLLALTQDEQKKWIG
HLGKKIPKTPPSTFSRASPRSMSTRSGPNQSFRRNPKSNTGKLS
NT seq 4095 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgggcaaagcatggaggctcgatttgaaaaaatcgatgccatgttgaaggac
ccaaagtcagaagtaaatacggattgtcttctggatggcttggatgcgctggtgtacgac
cttgacttccctgccctgaggaaaaacaagagcattgacaactttttgaatagatacaag
gaaaccattagtaaaatccgtgatctacgcatgaaagcagaagactatgaggtggttaaa
gttattgggaggggtgcatttggagaggtgcagttggtaagacacagagccacatgtaaa
gtatacgccatgaagctgctcagcaagtttgagatgatcaagaggtcggactctgctttc
ttctgggaggagagggacatcatggcttttgccaacagctcatgggtggtgcagctcttt
tttgctttccaagatgatcgctacctctacatggtgatggaatacatgcctgggggtgac
ttggttaacttgatgagcaactatgacgtcccagagaagtgggcccgcttttacacagct
gaggtggtgctggctctggatgggatccactccatgggcttcattcacagggacgtgaaa
cctgataacatgttgctagacaaggcaggccacttaaaactggcagattttgggacctgc
atgaaaatgaacaaggatggtatggtacgatgcgacacagcggtgggaactccagactac
atttcacctgaggtactgaaatcccaaggaggagatggctattatggcagagagtgtgac
tggtggtcagtgggagtgttcctgtacgaaatgctagttggcgacactcctttctatgca
gactcactggtggggacctatagcaaaattatgaaccacaagaacgccctgaccttccct
gaagacagcgacatctccaacgatgccaagaatctcatctgtgctttcctgactgacagg
gaagtccggcttggccgtaacggtgttgatgagatcaagaggcatcctttcttcaagaat
gaccagtggacatgggagaacatcagagaaacggctgctccagtagtgcctgagctgagc
agtgacattgacaccagtaactttgacgacattgaggaggatcggggagaggaggagacc
tttcccataccaaaggcctttgtgggcaaccagctccccttcgtgggcttcacttactac
agcaatcagcaccttttgcgcagctccaccaccacaaagaccagtgacaaacgtagcagc
tccacgaaggaagacaagagtcatctggaaaacctgcagaaacgaatctaccatctggag
gagcagctccacggtgagatgcagctgaaggatgagttggagcagaaatgcaggacgtca
aacaccaagattgacaagatcatgaaagaactggatgaagaggcaaaccttaggaagagt
gcagaggccagcgtgtctctgctggagaaggacaagatcatgctgcagcacagattcacc
gagtaccaaagaaaagctgaccaggaggcggagaagagacgcaatttggagaatgaggtg
tcaactttaaaggagcagcttgaagatatgaggaagatcagccagaactcgcaggcctcc
aatgacaagattgcccagctgcagaatcagctggaggaggccaatgacctgctgcgtgca
gagtcggacacggcagcgagactgaggaagagccacacggagatggcaaagtcaatgagc
cagttggagagtttgaaccgagagctgcaggagaggagccgcgcagccgacggtgagaag
gcccagctggagaaggaccttctgctcgttcagagcaccctggactcggagaggaggaac
tacagccagggatcagaggagatcagggagctgcaagcgaggatggcagggctgcaagag
gataacaaaaacttgaagctcagcctctccaaagtggaggcagaacgtaaacaagcccag
gagaggagcaataacctggagaaggaaaagaacaacctggagatagacctgaactacaaa
ctgaagaccttacagcagcgtctggagcaggaacagactgagcacagggtgacgcgggca
cagctcactgacaaatatgaatctattgaagaagccaaatcagctgccatgaatgctgtt
cagcagaagatgtctgaggagaatggagcgaggatgagagctgagagccgggtagtggag
gtggagaagcagtgctcaatgctagagtttgacctcaagcagtctgtgcagaagatggag
caattgatgaagcaaaaggaaaggctggaggatgaggtgaagaatctgcggatacaggtc
gagcaggagtcgagcaagcgtgtcctggctcagaatgacttgaagagccgcacgcaggag
gtggaccgtcttagatgttcggagaagcagctcaaacaggagatcaacacagcactagag
agtaaacgctcgctggagttccagctggcacagctgaccaaacaatacagaggcaacgag
ggacagatgagggaacttcaggaccagcttgaggccgaacagtatttttctacgctttac
aaaactcaggtcaaggagctaaaagaggagattgaggaaaggaaccggcaggtacaagag
gctaataaaaaggtgcatgagttgtgcagtgaaagggactccctgtccgcccagcttgat
ctgacggtgaccaaggccgagtcagagcagcttgctcgggcgcttcaggaggaacagtac
tttgagctcagccaggagagcaagaaggcggtgactagacataagcaggagatcggggaa
aaggaagctaccattgcacgacttgaagaatccaataaaactctgaccaaagatgtggag
aacctcagcaaagagaagtctgatttgaatgagaagcttcatattcaggatgaagagtat
gcagctcagaaggaggagattgcaaatacaatcaaggccacctatgagaaggtcctcaac
aatgagcgcacactgaagactcaggcggtgaacaagctggcagagatcatgaaccgcaag
gacatgaagctggaccagaagaagaagggcagcactgccgacctccggaagaaggagaag
gagaaccgcaagcttcagctagagcttaaccaggagaaggagaagtttaaccacatggcc
atcaagtatcagaaggagttgagcgagatgcaagcgcaactagcagaagaatgcacatat
cgcaacgagctgcagatgcagctggacagcaaggagagcgacatcgagcagcttcgggag
aaactgaacgacctgcaacagcgcatggataactcaagtgtcaccagtttgcagacagat
gagacagacagcaacatcgcagaatccagattggagggctggctgtccattcctaatcgt
gctaatatcaagcgatacggatggaagaagcagtatgtggtggtgagcagtaaaaagatt
ctgttctacaatgacgagcaggataaggaacagtccaacccctcaatggtactagatatc
gacaaactatttcatgtgagaccagtcactcaaggagacgtgtaccgggctgagacagaa
gagattccaaggatattccagattctgtatgccaacgagggggagtgcaggaaggaggcg
gacatggagacggtccctcagggcgacaagaccaactgtctcccacacaaaggccacgag
ttcatccccacgttatatcacttcccttcaaactgtgaggcctgcgccaagcctctgtgg
cacgtcttcaagccgcctccagctctggagtgtcgccgctgccacgtcaagtgccacaag
gaccacctcgacaaaaaggaggatgttattgctccttgcaaagtaaattacgacgtaacc
tctgcccgggacatgctcctgctggccctgacccaagatgaacagaagaaatggattggt
caccttggaaagaaaattcccaagaccccaccatctacattttcaagagcctctcctcgt
tctatgtccactcgctctgggccaaaccagtccttccgcaggaaccctaaaagcaataca
ggaaagctgagctaa

DBGET integrated database retrieval system