KEGG   Seriola dumerili (greater amberjack): 111231447Help
Entry
111231447         CDS       T05606                                 

Gene name
gucy1a3
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-3
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00230  Purine metabolism
sdu01100  Metabolic pathways
sdu04270  Vascular smooth muscle contraction
sdu04540  Gap junction
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111231447 (gucy1a3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    111231447 (gucy1a3)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111231447 (gucy1a3)
Enzymes [BR:sdu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     111231447 (gucy1a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 111231447
NCBI-ProteinID: XP_022614262
Position
Unknown
AA seq 678 aa AA seqDB search
MFCAKLKELKISGECPFSSSAKNNELGDLEERSADDADLLPISKDVHGKIGEDLPRQKTS
RAKVNLHTLGESIRKLACPEFQRLHTALHRMMRLSDHTRDSESPRICCTDNQSCSDEPEH
LVEMINIYSTKTAIPMEALKVALGEELFNMCYEEDGHILRVVGGALHDFLNSFNVLLKQS
STLPNPDREDYVNEPSVLCLDKDPGLLTVYFFNPRPTTQLFFPGVIKAAARLLYHTTVDV
LMDPPSAKDSILQSSPQASLLYTVVVKDAKNLSPSPLRATSAGTLPTTLFSTIFPFHLIL
DQDLVLVQIGHGLRKRLTRKDGLRRSATFQEHFSIVSPQIKCTFQGILTMLNTQFIIRIK
HGVYTTDITGKLMDLKGQMIYVSESNAILFLGSPCVDKLEELTGRGLYLSDIPIHNALRD
VVLVGEQAKAQDGLKKRLGKAKAALEHAHQALEEEKKKTVDLLFSIFPGTVAQQLWQGQT
VQAKKFDRVTMLFSDIVGFTAVCSLCTPMQVITMLNELYTRFDHQCGELDVYKVETIGDA
YCVAGGLHKESGTHAVQIALMALKMMELSDEVMTPTGDPIQMRIGLHTGSVLAGVVGVKM
PRYCLFGNNVTLANKFESCSQPRKINISPTTHRLLKDRPEFVFVPRSRQELPANFPEDIP
GVCYFLEASFKTSKLTLK
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgttctgcgctaagctgaaagaactgaagatatccggagaatgtccattctccagcagc
gccaaaaataatgagctcggagacttagaggagcgctcagctgacgacgcggatttattg
cctatttctaaggacgtgcacggaaaaataggtgaggatctacctcgacagaagacaagc
agagccaaagttaacctgcatacacttggggagagcatccgaaaattggcatgtcctgag
tttcaaaggctgcatactgccctgcaccgaatgatgagactatcagatcacaccagggac
tctgaaagtccaagaatttgctgcacagacaatcagagttgcagtgatgaaccagagcat
ttagtggagatgataaacatttactcaaccaaaacagcaatcccaatggaagctttgaaa
gttgctcttggcgaagagcttttcaacatgtgttatgaggaggacggacacattttgagg
gtggtggggggagctctccacgacttcctcaacagcttcaatgtcttgttgaagcagagc
agcacgctacccaacccggacagagaggattatgtaaacgaaccatcggtgctgtgctta
gacaaggatccgggtctgcttactgtctatttcttcaacccccgcccgaccactcagctc
tttttccccggagtcatcaaagctgctgcccgcttgctgtatcacaccactgtggatgtg
ttgatggacccccccagtgctaaagacagcatcttgcagtccagcccacaggccagtctt
ctgtacacagttgttgttaaggatgctaaaaatctgagccccagcccgctgcgggctacc
tcagctgggacccttcctaccactctgttctccaccattttccctttccatctgatcctg
gaccaggacttggttctggttcaaataggacatgggctcaggaagagactgaccagaaag
gatggactgaggcggtctgctaccttccaagaacacttctctattgtctctccccagatc
aaatgtacctttcaaggtattctgaccatgctaaacacacagtttatcattcggatcaag
catggagtctacaccacagacatcacagggaagctcatggaccttaaaggtcagatgatc
tacgtgtcagagtccaatgccattttgttcctaggctcaccatgcgtggacaagctggag
gagctaacaggccgtggtctctacttgtcagacatccctatccataatgcgctgcgtgac
gtcgttctggttggtgaacaggccaaagcccaggacggtttgaagaagcgtctggggaag
gccaaggcagccttggagcatgctcaccaagcgctggaggaggagaagaagaagacagtg
gacctcctcttctccattttccctggcactgtggcacagcagttgtggcagggacaaaca
gtccaggccaagaagtttgacagggttacaatgctcttctctgacattgtgggcttcacg
gctgtttgctccctctgtaccccaatgcaagtgatcaccatgctcaatgagttgtacacc
aggtttgaccaccagtgtggagagcttgatgtttataaggtggagaccattggtgatgcg
tactgtgtagctggtggcttacacaaggagagtgggactcatgctgtccaaattgcactc
atggccttaaagatgatggagctctcagacgaagtcatgacaccaactggagacccaata
cagatgcgtatcggcctccacactggttcagttctggctggtgtagtaggggtgaagatg
ccacgctactgcctttttgggaacaatgtcacattggccaacaagtttgaatcctgcagc
caacctagaaaaatcaatatcagccctacaacccacagattgctgaaggatcgcccagag
tttgtctttgttcccaggagcagacaggagcttccggccaacttcccagaagacatccct
ggtgtttgttactttttggaggcctccttcaaaacttcaaaactgactctgaaatga

DBGET integrated database retrieval system