KEGG   Seriola dumerili (greater amberjack): 111231620Help
Entry
111231620         CDS       T05606                                 

Gene name
etnppl
Definition
(RefSeq) ethanolamine-phosphate phospho-lyase
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00564  Glycerophospholipid metabolism
sdu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111231620 (etnppl)
Enzymes [BR:sdu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     111231620 (etnppl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 111231620
NCBI-ProteinID: XP_022614528
Position
Unknown
AA seq 489 aa AA seqDB search
MSLERFEKKKTLDLRKKHIGPSCKIFFSHDPIKIVQAKGQYMYDEKEQSYLDCINNVAHV
GHCHPDVVKAGAQQMELLNTNSRFLHDNLVVYAQRLQATLPEKLSVCYFVNSGSEANDLA
LRLAWQYSGHKDIITLENAYHGHVSSLIDISPYKFHQLSDAEQNQFVHVAPSPDVYRGKY
RADHPDPATAYADEVKDIINKVHKKGGKIAAFIAESLQSCGGQVIPPVGYFQQVAEHVRK
AGGVFIADEVQVGFGRVGTHFWAFQLQGEDFVPDIVTMGKPIGNGHPMSCVVTTREVAEA
FMSSGMEYFNTFGGNPVSCAIGLAVLDVIVKEDLQGNALRVGRYLTNLLEKQKEKHPLVG
DIRGCGLFVGVELVRDRSKLTPATAEAQEVIYKLKEQHILLSADGPHRNVLKFKPPMCFT
TEDADLVVEKIDHILTELEKALGLKLPNMVNPENECSKRKLPTDENGHQYHSGLVQNRGS
SQQTKRLKT
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtctttggaaaggtttgagaaaaagaagacgctagacttgaggaagaagcacattggg
ccatcctgtaagattttcttcagccatgaccctatcaagattgtgcaagccaaaggccag
tacatgtatgatgaaaaagagcagagctacttggattgcatcaacaatgtggctcatgtg
ggccactgtcacccagatgtggtgaaggctggagctcagcagatggaactacttaacacc
aactcacgtttcttgcatgacaaccttgtagtctatgcccagaggctgcaggccacactg
cctgaaaagctgtcagtgtgctactttgttaactctggttctgaggccaacgacctggcc
cttcgactagcatggcagtacagtggccacaaagacatcatcacgttggagaatgcgtac
cacggccacgtctcatcgctcattgacatcagtccgtataagttccaccagctgtcagat
gctgagcagaatcaatttgtccatgtggccccaagcccagatgtgtacagaggcaaatac
agagcagaccatcctgatcctgcaacagcatatgcagatgaagtcaaagatataataaac
aaagtccacaagaaaggaggcaagattgctgcttttattgctgagtcactgcagagttgt
ggtgggcaggtcattccccctgtgggctacttccagcaagtggcagaacatgtccgtaag
gcaggtggcgttttcatcgccgatgaggtccaagtgggctttgggcgtgttggcacccac
ttttgggccttccagcttcagggagaggactttgtgcccgacattgtcaccatgggaaaa
cctattggcaacggtcaccccatgtcatgtgtggtgacgaccagagaggtggcagaggcc
ttcatgtcatctggaatggagtatttcaatacatttggcggtaacccagtgtcatgtgcc
atcggactggccgtcctggatgtgattgtgaaagaggatctccagggtaatgcactgcgt
gtggggcgatacctgaccaatctgctggaaaagcagaaagagaagcatccactggtcgga
gatatcaggggttgtggcctctttgttggggtggagcttgtgagggacaggtcgaagctc
actcctgctacagcagaggctcaagaagtcatatataagctaaaggaacagcacatcctt
cttagtgctgacggaccacatcgcaatgtgctcaaatttaaaccccccatgtgcttcact
acggaggatgctgacctggtggtggagaaaatcgaccacattctcacagaacttgagaag
gcattaggcttgaagttgcccaacatggtgaatccagagaatgaatgcagtaaaagaaag
ctgccgactgatgaaaatggacaccagtatcacagtggtttagtacagaacagaggaagc
agtcaacaaaccaaacgcctcaagacataa

DBGET integrated database retrieval system