KEGG   Seriola dumerili (greater amberjack): 111232269Help
Entry
111232269         CDS       T05606                                 

Gene name
pla2g4a
Definition
(RefSeq) cytosolic phospholipase A2
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00564  Glycerophospholipid metabolism
sdu00565  Ether lipid metabolism
sdu00590  Arachidonic acid metabolism
sdu00591  Linoleic acid metabolism
sdu00592  alpha-Linolenic acid metabolism
sdu01100  Metabolic pathways
sdu04010  MAPK signaling pathway
sdu04217  Necroptosis
sdu04270  Vascular smooth muscle contraction
sdu04370  VEGF signaling pathway
sdu04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111232269 (pla2g4a)
   00565 Ether lipid metabolism
    111232269 (pla2g4a)
   00590 Arachidonic acid metabolism
    111232269 (pla2g4a)
   00591 Linoleic acid metabolism
    111232269 (pla2g4a)
   00592 alpha-Linolenic acid metabolism
    111232269 (pla2g4a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111232269 (pla2g4a)
   04370 VEGF signaling pathway
    111232269 (pla2g4a)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111232269 (pla2g4a)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    111232269 (pla2g4a)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111232269 (pla2g4a)
Enzymes [BR:sdu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     111232269 (pla2g4a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 111232269
NCBI-ProteinID: XP_022615469
Position
Unknown
AA seq 749 aa AA seqDB search
MASNIIVEQQFSHKFTVTVVRAENVTKGALGDLLDTPDPYVELFIPTAPESRKRTKHIDN
DINPKWGETFHFILDPNQQNVLELTLMDANYVMDETLGTTSFDLTKLRVGQTKMETFFIG
KATKVYLEMSLEICTNLDLRFSLALCDKEKQFRQTRRERVMLGIKKLLDMEKPRFLPSSP
QEVPVIAIAGSGGGFRAMVGFSGVMKALFESGVLDCATYVAGLSGSTWYMSTLYSHPDFP
NKGPMDINKELMKRVSSNPLRLLLPQHITNYIQALWTKKASGQPVTFTDIFGMLIGETLI
PARMDTKLSEIQEKTDQAQSPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYGTFMT
PDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVKDTAGGSTMEEELEQIK
PQHIVGEDSLDNDDEPRKGGTENQEAEDEFHRTAQASWVQRMFTSLFSDSALFNTREGRA
GKVHNFMLGLNLNTSIPFSPVTEVTYHTPPPEEEVDAVTDPDEFDRIYEPLDVKSKKIHV
VDSGLTYNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWARMNKLPFPKI
DPKVFDREGLKECYVFKPKKGEKNCPTVIHFVLVNINFRQFKAPGVPRETEKEKELADFD
IFDDPESPFSTFNFQYSNEAFTRLHDLMEFNTLNNLEVIKEAIKDCIVSRKENPSGLSLP
FSLSEIPKKKFFRRDPHPKPWNHLGNDNQ
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaatataattgtggaacagcagttttctcacaaattcacagtgacagtggtt
cgagctgagaacgtcaccaagggagcactgggtgacctgttggacaccccagatccatat
gtggagctgttcatcccaacagccccagagagcagaaagaggaccaagcacatagacaac
gacatcaacccaaaatggggcgaaacctttcacttcatattagaccccaaccagcagaac
gtcctggagctaacattaatggatgcgaattatgtgatggatgagacacttgggacgaca
tccttcgaccttaccaagcttagagtgggccagacaaagatggagactttctttattggc
aaagcaaccaaagtgtacttagagatgtcgctggagatttgtaccaacctggacctgcgg
ttcagcctggccctgtgtgacaaagagaaacagttcagacaaacccgcagagaaagagtg
atgctgggcatcaagaagctgctagacatggagaagcctcgtttcctccccagctctcca
caggaggtaccagtgatagccatagcaggctcaggaggcggtttccgtgccatggtgggc
ttctcaggtgtgatgaaggcgctgtttgagtctggggtcctggattgtgccacatatgtc
gccggcctctctggatccacatggtacatgtcaactctctattcccaccctgactttcca
aacaagggcccaatggatatcaacaaggagctaatgaagagagttagcagtaacccactg
aggctgttgctgccccaacacatcaccaactacatccaggccctttggaccaaaaaggcc
tcagggcagcctgttacctttactgatatctttggtatgctcataggagagacgcttatt
cccgcgagaatggacactaagctaagtgaaatccaggagaagacagaccaggcacagagt
ccccttcctctcttcacatgtctgcatgtcaagccagatgtttctgagctcatgtttgca
gactgggtggagttcagcccatatgaaattgggatggcaaagtacggtaccttcatgacc
ccagacttgtttggaagcaagttcttcatgggaactgttgtgaagaaatatgaggaaaac
cctcttcattttctgatgggtgtgtgggggagcgccttctcgattctgttcaacagagtg
ctgggcgtcaaagacacagctggtggcagcaccatggaggaggagttagagcagatcaaa
ccgcagcacattgtcggggaagacagtttggacaatgacgacgagccacgcaaaggtggg
acagagaaccaggaggcagaggatgagtttcatcgcactgctcaggccagctgggttcag
cgaatgttcacatcgctcttcagtgattctgccttgttcaacacaagagagggcagggct
gggaaggtgcataacttcatgctgggcctgaacctgaacaccagcatcccattctctcca
gtcactgaggttacatatcacactcctccacctgaggaggaggtggatgctgtcacagac
ccagatgagtttgatcgtatctacgagcctctggatgtgaagagtaagaagatccacgtg
gtggacagcggcctgacctacaacctcccgtaccctctcatcctgcggccgcagcgtggc
gttgacctcatcatctcctttgacttttctgcacgaccaagcgactcaagcccaccattc
aaggagcttctgctagcagaaaagtgggctcgaatgaacaagctcccattccccaagatc
gacccaaaagtctttgaccgcgaaggcctgaaggaatgctatgtcttcaaaccaaaaaaa
ggagaaaagaactgccctactgtcatccactttgtcctggtcaacatcaacttcaggcag
ttcaaagcgcctggtgttcccagagaaactgagaaggagaaggagttggcggattttgac
atttttgacgaccccgagtcacctttctccactttcaatttccagtactccaacgaggcc
tttacccgactccacgacctcatggagttcaacactctcaacaacctggaggttattaaa
gaagccatcaaagactgcattgtctctcggaaagagaacccctcaggcctctcccttccc
ttctcactcagcgagatcccgaaaaagaagtttttcagaagagatcctcacccaaaacct
tggaatcacttgggaaatgataaccagtag

DBGET integrated database retrieval system