KEGG   Seriola dumerili (greater amberjack): 111232395
Entry
111232395         CDS       T05606                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04080  Neuroactive ligand-receptor interaction
sdu04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111232395 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111232395 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 111232395
NCBI-ProteinID: XP_022615616
Position
Unknown
AA seq 77 aa
MNVKILTLVIVLLVSLLCSASAGPMASMEHGRELEEASTVRKMVQQSPARGGQTHRPAGW
KRRRPRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgttctgcc
agtgctggtcccatggcctccatggagcatggcagagagctggaagaggcctctacagtg
agaaaaatggtccagcaaagccctgcgaggggcggtcagacccacagaccagccggctgg
aagaggagacgcccacggccccgtctttcccacaaggggcccatgccgttctag

DBGET integrated database retrieval system