KEGG   Seriola dumerili (greater amberjack): 111232592Help
Entry
111232592         CDS       T05606                                 

Gene name
htr4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04020  Calcium signaling pathway
sdu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    111232592 (htr4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111232592 (htr4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sdu04030]
    111232592 (htr4)
G protein-coupled receptors [BR:sdu04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    111232592 (htr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Git3
Motif
Other DBs
NCBI-GeneID: 111232592
NCBI-ProteinID: XP_022615897
Position
Unknown
AA seq 439 aa AA seqDB search
MWTFLRNLEKMFNSFDKMFTEMFKVKWTEVSNKNNRKQGDNFDASLTEEDSKKKDEEEED
SEEADGFTGGDSMPKRMALICFLSLVMLMSILGNLLVMVAVCKDRQLRKIKTNYFIVSLA
FADLLVSVLVMPFGAIELVHQHWIYGETFCLVRTSLDVLLTTASILHLCCIALDRYYAIC
CQPLVYRNKMTPMRVALMIGGCWVIPTFISFLPIMQGWNSIGIDHLIEQRRHSDGSNSTS
CVFMVNKPYALTCSVVAFYIPLVLMVLAYQRIYVTARAHALQISMLQRAGGAAGTSGAGV
DSADHQRNHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNVVDPFIDYTVPDKLWAACLWL
GYINSMLNPILYAFLNKSFRRAFLIILCCGRKRYRRPSILGSGAPCTATQINGSTHVLNG
CSSASKLLLWFCNTRPVPV
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgtggacctttctgaggaatttggagaaaatgttcaactcgtttgataaaatgttcact
gaaatgttcaaagtcaagtggacggaggtgtcaaacaagaacaaccgtaagcaaggagac
aactttgatgcctcgctgacagaggaagactctaagaagaaggatgaagaagaagaggac
tcagaagaagctgatggatttacaggaggcgacagcatgccaaagcggatggctctgatc
tgcttcctgtctctggtcatgctgatgagcatcctgggaaacctgctggtcatggtggcc
gtctgcaaggacaggcagctcaggaaaatcaagaccaattacttcatcgtgtctctggcg
tttgctgacttgctcgtatcggtgctggtgatgccgttcggtgccatcgagctggtccac
cagcactggatctacggcgagactttctgtctggtccgtacgtcgctggacgtcctgctg
accacagcgtccatcctgcacctgtgctgcatcgccctggacaggtactacgccatttgc
tgccagccactggtctaccggaacaaaatgacaccaatgcgagtggctttgatgatcggc
ggctgctgggtcatccccaccttcatctccttcctgcccatcatgcagggctggaacagc
atcggcattgaccacctgatcgagcagaggcgccacagtgatggcagcaactccacatcc
tgtgtcttcatggtcaacaagccgtacgccctcacctgctctgtggtggccttctacatc
cccctggtcctcatggtgctggcctaccagaggatctacgtcacggcccgtgcacacgcc
ctgcagatcagcatgctgcagcgggcaggaggagcggcgggcacttctggcgctggggtt
gactctgctgaccatcaacgcaaccaccgcatgcgaacagagacgaaggcagcaaagact
ttgtgcatcattatggggtgtttctgcctctgctgggcacccttctttgtcaccaatgtg
gtggacccctttatagactacacagtgccagacaaactgtgggcggcctgcctttggctg
ggctacatcaactccatgctgaaccccatcctctacgccttcctcaacaagtccttccgc
cgtgccttcctcatcatcctgtgctgtggcaggaagaggtaccgcaggccgtccatcctg
gggtccggcgctccctgcacagccacgcagatcaacggctccacacatgtactcaatggc
tgctcctctgcctccaagctcctgctctggttctgcaacaccaggccagtgcctgtctag

DBGET integrated database retrieval system