KEGG   Seriola dumerili (greater amberjack): 111233002
Entry
111233002         CDS       T05606                                 

Definition
(RefSeq) N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming) B-like
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
sdu  Seriola dumerili (greater amberjack)
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111233002
Enzymes [BR:sdu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     111233002
SSDB
Motif
Pfam: AstE_AspA PDT RRM_1
Other DBs
NCBI-GeneID: 111233002
NCBI-ProteinID: XP_022616447
Position
Unknown
AA seq 337 aa
MEVDEVVCLPRLSRVAVCGGTHGNELSGVYLVRELLKAEKKVRKKEEEEEEPLSVQMVLS
NPRAMQQCRRYIDTDLNRCFTHATLNGSTSDSDPYEMIRSRELNAMLGPKGSPKAVDLVC
DLHNTTANMGLCLIAYSDCDWICLHIFRHLQRQMPDIPLRYIHFDVSSKESYSLDSVGKH
GFAMEIGPQPHGVVRSNIYTAMKVGVQHVLDWVRFFNSGTIFEGGFVDVFTMVKHIDYPR
DSETHNITAAIHPQLQDRDFCLLHPEDALFQTFSGETLRYKGNEPLYPFFVNECAYYEKG
IALSLARKRHVMIPAIRVQTEQEQQANEQGFASEEEE
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggaagtagacgaggtggtgtgtttaccgaggttgtcccgggtcgctgtgtgcggtggt
acccatggcaacgagttgtctggggtgtacttggtgagagagctgctgaaggcggagaag
aaagtgaggaaaaaagaggaggaggaagaggagcctctgtcggtgcagatggtgctgtcg
aacccacgggccatgcagcaatgccgcagatacatcgacaccgacctgaaccgctgcttc
acccacgccaccctcaatggttccacgtcagactcggacccctacgagatgatcaggtcc
cgagaactgaatgcgatgctgggtcccaaaggcagtcctaaggcggtggatcttgtttgt
gacctccataacaccactgccaacatgggcctgtgcctcattgcgtactctgactgcgac
tggatctgcctgcacatattcagacaccttcagaggcagatgccagatataccattgagg
tacatccatttcgatgtctccagtaaagaatcatattcccttgattcagtgggaaaacat
ggctttgccatggagatcggccctcagccccacggtgtggtgcggtcaaacatctatacg
gcgatgaaagttggtgttcagcatgtgctcgattgggtccgtttcttcaactcaggtact
atttttgaaggaggatttgtggatgtgttcaccatggttaaacacattgactacccaaga
gacagcgagactcacaacatcacagcagccattcatcctcaactccaggaccgagacttc
tgcctgctccaccctgaggatgcactgttccagactttctcaggtgaaacactgaggtat
aaaggcaatgaaccactttatcctttctttgtcaatgaatgtgcgtattacgagaagggc
atcgctctctccctggcgagaaagaggcatgtgatgattcctgcaatccgggtgcagaca
gagcaggagcaacaagctaacgaacagggatttgcatcagaagaagaggagtga

DBGET integrated database retrieval system