KEGG   Seriola dumerili (greater amberjack): 111233581
Entry
111233581         CDS       T05606                                 

Gene name
rdh5
Definition
(RefSeq) 11-cis retinol dehydrogenase isoform X1
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    111233581 (rdh5)
Enzymes [BR:sdu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     111233581 (rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776 NAD_binding_10
Other DBs
NCBI-GeneID: 111233581
NCBI-ProteinID: XP_022617152
Position
Unknown
AA seq 354 aa
MFFQPARSPPGDQKPTSNPGSSMDTQYVYDLLGENAWLYISATFVVLWILVWLYRDSLEI
ENITDKYVFVTGCDSGFGNLLCKKLDRKGFRVLAGCLTEKGADDLKRVAGPYLKTVLLDV
TNQDSIQKAMEYTKEVVGDKGLWGIVNNAGRSLPMGPSEWMKVEDFHSTLKVNMNGVIAM
TMTFLPLIKKARGRIVNVASVLGRVAANGGGYCISKFAVESFSDCLRRDINYFGVNVCII
EPGFFKTAVTSLDPLERELHRLWNQLSPEVQASYGDKYLDKYIKVQRLIMNAICDSDLTK
VTSCMEHALTAAYPRSRYSAGWDAKLIWIPLSYMPSCVVDIGLKLVLPRPSKSV
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgttttttcagccagcacgatctcctccaggtgaccaaaaacccacttctaatcctgga
agcagcatggatacacagtatgtctacgaccttttaggggaaaatgcttggttgtacatc
agtgccacctttgtggtgctgtggattcttgtgtggctgtacagagacagcctagagatt
gagaacatcactgacaagtacgtctttgtgaccggctgcgactctgggtttggaaacttg
ctgtgtaagaagctcgatcgaaaaggtttccgtgtgctggctggctgtctcacagaaaag
ggagctgatgatctgaagcgggtggcagggccttatttgaagactgtcctgctggatgtg
accaatcaggacagcatccagaaagccatggagtataccaaggaggtggttggcgataag
gggctttggggtattgtgaacaatgctggacgctcattacccatgggcccttcagagtgg
atgaaagtggaggatttccacagtacactgaaagtcaacatgaatggagtgatcgccatg
acgatgactttcctgcctctcatcaaaaaggcccgaggccgcattgtaaacgtagcatca
gtactcggtagagtggctgcaaacggtggtggatactgcatctccaagtttgcagtggag
tctttctctgactgcctcaggagagatataaactactttggagtcaatgtatgcatcatt
gagccggggtttttcaagactgcagtgacgagcctcgaccccctcgagagggagctgcat
cgcttgtggaaccagctcagccctgaagtccaagccagctatggagacaagtaccttgat
aagtacatcaaggtccagcggttgatcatgaatgctatctgtgactctgacctgaccaag
gtgaccagctgcatggagcatgctctgacagcggcctacccacgcagcagatacagcgcc
ggctgggatgccaagcttatctggatccccctctcttacatgccttcctgtgtggttgat
attggcctgaagctggtgctgcctcgtccttcaaagagtgtgtaa

DBGET integrated database retrieval system