KEGG   Seriola dumerili (greater amberjack): 111233613
Entry
111233613         CDS       T05606                                 

Definition
(RefSeq) acid-sensing ion channel 1B-like
  KO
K04829  acid-sensing ion channel 1
Organism
sdu  Seriola dumerili (greater amberjack)
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:sdu04040]
    111233613
Ion channels [BR:sdu04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   111233613
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 111233613
NCBI-ProteinID: XP_022617191
Position
Unknown
AA seq 560 aa
MPVRIMCTISFSADDEPSRGYGKDGFDDHYKRVKKSYGDGDSQDYLDGCSQVDDYNDEEE
NISEVDDLAAFFSGCSLHGANHVFVENKRFGIRQGLWAVVFTMALSAFLFQVADRVIYYL
QYDYITMLDERVANNMTFPAVTICNYNFIRKSQMSYSDLIFMGPLLGFEEGMAPGFPLAP
EPDRPPGSRFSLDEFYNRTRHRIEDILLECDFRGLECGPENFREIFTRYSQCYTFNSGQD
GRPLLVTMKGGMGNGLELMLDIQQDEYLPVWGETDETSFEAGIKVQIHTQDEPPFIDQLG
FGVAPGFQTFVSCQEQRLTYLPPPWGDCKATPMDSDFFSTYSITACRIDCETRYLVENCN
CRMVHMPGDAPYCTPEQYKECADPALDFLVERDNDYCVCETPCNLTRYGKEMSFVKIPSK
ASAKYLAKKFNKTEQYIADNILVLDIYFEALNYETIEQKKAYELAGLLGDIGGQMGLFIG
ASILTILELFDYLYEVIKYKLCRCVKKKHKGRNNNDRGAVLSLDDVKRHAPCENLRTPST
YPGNMLPHHPGQGNFEDFTC
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgcctgtccgaatcatgtgcaccatctccttttctgccgatgacgagcccagcagagga
tatggcaaagatggttttgatgaccactacaagcgcgtgaagaagagttacggcgacggg
gactcacaggactacctggatgggtgtagtcaggtggatgattacaatgatgaggaagaa
aacatcagcgaggtggacgaccttgcagctttctttagcggctgctcactgcacggtgca
aaccatgtgttcgtggagaacaagaggtttggtattcgtcagggtttgtgggcggtggtc
ttcaccatggccctgtccgctttcttgttccaggtagctgacagggtcatatactatctc
caatacgattacatcaccatgctggatgaaagagtggccaacaacatgacctttccagct
gtcaccatatgtaactacaacttcattcggaaatctcagatgagctacagcgacttgatt
ttcatgggccccctgctgggcttcgaagaaggcatggcaccagggtttccgctcgccccg
gagccggaccgcccgccgggctctcgtttcagcctggatgagttctacaaccgcactaga
caccgcatagaggacattctgctggagtgtgacttcagaggcttagagtgtggccccgag
aacttcagagaaatattcacacgctattctcaatgctacacctttaattcaggccaagat
ggacgacccctgttggtgacgatgaagggtgggatgggcaatggcctggagctgatgttg
gacatccagcaggacgaatacttgcctgtatggggagagactgacgagacatcgtttgaa
gcagggatcaaagttcagatccatacccaggacgagccgccgttcatagaccagctgggc
ttcggtgtggcgcctgggtttcagacctttgtatcctgtcaggaacaacggctgacatac
ctgcctccgccgtggggggactgcaaggccacgccgatggactccgatttcttcagcact
tacagcatcacagcctgccggatcgactgtgagacacgatacctggtggagaactgcaac
tgcaggatggtgcacatgccaggagatgccccatattgcaccccagagcagtacaaagag
tgcgcagatcctgccttggacttccttgtcgagagggataatgactactgcgtgtgcgag
acgccgtgcaacctgacacgctacggcaaagagatgtcctttgtcaagatacccagcaaa
gcatcagccaagtatcttgcgaagaaattcaataagacagagcagtacatagctgataac
attctggttctggatatctactttgaagcgctgaactacgagaccattgaacaaaagaaa
gcctatgaattggcaggccttctgggtgatattggaggtcagatgggccttttcattgga
gccagcatcctgaccattctcgaactctttgactatctatatgaggtgatcaagtacaag
ctgtgccgatgcgtgaagaagaaacacaaaggccgcaacaacaatgaccggggagctgtg
ctgagcctggatgatgtgaaacgccatgctccttgcgagaacctgcgtacaccatcaaca
tatcctggcaacatgctacctcatcacccgggccagggtaactttgaagacttcacttgc
tga

DBGET integrated database retrieval system