KEGG   Seriola dumerili (greater amberjack): 111233667Help
Entry
111233667         CDS       T05606                                 

Gene name
aldh5a1
Definition
(RefSeq) succinate-semialdehyde dehydrogenase, mitochondrial isoform X1
  KO
K00139  succinate-semialdehyde dehydrogenase [EC:1.2.1.24]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00250  Alanine, aspartate and glutamate metabolism
sdu00650  Butanoate metabolism
sdu01100  Metabolic pathways
Module
sdu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    111233667 (aldh5a1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    111233667 (aldh5a1)
Enzymes [BR:sdu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     111233667 (aldh5a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 111233667
NCBI-ProteinID: XP_022617261
Position
Unknown
AA seq 513 aa AA seqDB search
MSTICVLRASCLLRQVFPGLRAAMQRRYSLDVTGPLLRTQGYVDGRWVSAASVFPVLDPA
TGQEIARVADCGPAEAKQAVDAAYKAFHSWKQYTAKERSVLLRKWFDLLTLHKEDLAKLI
TFECGKPLRESLGEIAYSASFLEWFSEEARRVYGDIVPSPAKDRKIFLLKQPVGVASIIT
PWNFPSAMITRKVGAALAAGCTVVIKPAEDTPLSALALAELAEQAGIPAGVFNVVPCSRE
KTPSVGEVLCTDPLVAKISFTGSTATGKVLLKMAADTVKKASMELGGHAPFIVFDSADVD
KAVGGAMASKFRNSGQTCVCSNRFLVQGGIYDRFMERLGRAMDAELRVGHGSDPETTQGP
LINTRAAEKVVQQISDAVSRGAKVLKGGKRLDGSFMEPTLLADVTKEMLCTKEETFGPLL
PVIRFNTEDEALAIANASNVGLAGYFYSQDVSQIWRVAEALETGIVGVNEGLLSTPEATF
GGVKQSGLGREGSKYGIDEYLDVKYMCFGGLKP
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgatctgtgtgctgagggctagctgcttactccggcaggtcttccccggcctg
cgcgccgctatgcagaggcgctacagcctagatgtcaccggtccgctgctccggacgcag
ggttacgtggacggccgttgggtctccgcagcctcggtgtttcccgtcctggaccccgcc
accgggcaggagatcgcccgggtggcggactgtggcccggccgaggcaaagcaggctgtg
gacgctgcgtacaaggcgtttcactcctggaagcagtacacggctaaggagaggagcgtc
ctgttgaggaaatggttcgacctgctgacgctgcacaaagaagacctggctaaactgatc
acattcgaatgtgggaagccgctgcgggagtctctcggggagatcgcgtactcggcctcc
ttcctggagtggttttcagaggaggcgcggcgagtttatggcgacatcgtcccctcaccc
gccaaggacagaaagatcttcctcctcaaacagccagtgggggtcgcctccatcatcaca
ccgtggaacttccccagcgccatgatcaccaggaaggtgggggccgctctggcggccggc
tgcacggtggtgatcaaaccggcggaggacaccccgctgtcggcgctggctctggctgag
ctggcagaacaggcggggatcccggcaggggtgtttaacgtggtcccttgctccagagag
aagactccgtcggtcggggaggtcctctgcaccgaccccctggtagcaaaaatctccttc
actggctccaccgccaccggcaaggtgttgctgaaaatggccgccgacactgtgaagaag
gcgtccatggagctcggtggccacgcccccttcatcgtgtttgacagtgctgatgtcgac
aaggcggtgggcggagccatggcctccaagttcaggaactctggacagacttgtgtgtgt
tcgaaccggtttctggttcagggcgggatctacgatcgcttcatggagagactcggccga
gcgatggacgctgagctccgtgtaggtcacggctcggatcccgagaccacccaggggccg
ctcatcaacaccagagctgcagagaaggtggtccaacagatttcagatgcagtgtcccgg
ggagcgaaggtgttgaagggcgggaagcgtctggatgggtcctttatggagccgactctg
ctggccgacgtcaccaaggagatgctgtgcaccaaagaggaaacctttggcccgctgctg
cccgtcatcaggtttaacacagaagatgaggctctggccatcgccaacgcctccaacgtt
ggactggcaggttatttctactcgcaggatgtgagtcagatctggcgggtggcggaggcg
ttggagacgggaatagttggagtgaacgagggcctgctgtccaccccagaggccaccttt
ggtggggtcaaacagtccgggttgggccgcgagggctccaagtacggcatcgatgagtat
ctggacgtcaagtacatgtgctttggaggcctcaagccctaa

DBGET integrated database retrieval system