KEGG   Seriola dumerili (greater amberjack): 111236912Help
Entry
111236912         CDS       T05606                                 

Definition
(RefSeq) septin-7 isoform X1
  KO
K16944  septin 7
Organism
sdu  Seriola dumerili (greater amberjack)
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sdu04131]
    111236912
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sdu04812]
    111236912
   04147 Exosome [BR:sdu04147]
    111236912
Membrane trafficking [BR:sdu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    111236912
Cytoskeleton proteins [BR:sdu04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     111236912
Exosome [BR:sdu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   111236912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 KAP_NTPase AAA_16 FeoB_N AAA_22 Ras Gtr1_RagA GTP_EFTU AAA_29 AAA_7 ABC_tran Roc
Motif
Other DBs
NCBI-GeneID: 111236912
NCBI-ProteinID: XP_022621545
Position
Unknown
AA seq 426 aa AA seqDB search
MAQQKNLEGYVGFASLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSSEY
PGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPIIDHIDSKFED
YLNSESRVNRRQMPDSRIHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNVIPLIAKADTLT
PEECQQFKKQIMREIQEHKIKIYEFPETDDEEENRLVKKIKDKLPLAVVGSNTIIEVNGK
RVRGRQYPWGVAEVENSDHCDFTILRDMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN
GVDNNRAKGQLSTKLDTVEGMSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKL
KDSEAELQRRHEQMKKNLEAQHKELEEKRRVFEDERANWEAQQRLEQQKLEASRTLEKNK
KKGKIF
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggctcaacaaaagaatctggaaggatatgttggctttgcaagcctccccaaccaagtg
tacaggaagtctgtcaagaggggctttgagttcaccctgatggtcgtgggtgaatccggc
cttggcaaatccacgttgatcaactctctgttcctaacagacctgtattcatcagagtat
cctggaccgtcacatcgaatcaaaaagactgtacaggtggagcagtccaaagttttaata
aaggagggtggcgtccagctgctgctcacaatagttgacaccccagggtttggagatgct
gtcgacaacagcaactgctggcagccgatcattgaccacatagacagcaagtttgaagac
tacctgaactcagaatctcgggtgaatagaagacagatgcctgacagcagaatccactgc
tgcctgtactttatcgccccctcgggacacggactgaaacccctggacattgagttcatg
aaacggttgcatgagaaagtcaatgtcatcccactgatcgccaaagcagacaccctcact
ccagaggaatgccaacagttcaagaagcagatcatgcgggaaatccaagagcacaaaatc
aagatctacgagttccccgagacagacgacgaagaggagaacaggctggtgaagaagatc
aaagacaagttgccactggctgtagtaggaagcaacaccatcattgaggtgaacggcaaa
agggtcagagggagacagtacccctggggggttgcagaagttgaaaacagtgaccactgc
gacttcaccatcctcagggacatgctcatcagaactcacatgcaggacctgaaggatgtg
acaaacaatgtccactatgaaaactaccgcagcaggaagctggccgctgtcacctacaat
ggagttgacaacaacagggccaaaggacaactgtccaccaaacttgacacagttgaagga
atgagtcctctggcccagatggaggaggagaggcgagagcatgtggctaagatgaagaag
atggagatggagatggagcaggtgtttgagatgaaagtcaaggaaaaagtgcagaagctc
aaagactcagaagcagagcttcagcggcgtcatgagcagatgaaaaagaacctggaggct
cagcacaaggagctggaggagaagagacgcgtgtttgaggatgagagagcgaactgggag
gcccagcagcgcctggagcagcagaaactggaggcctccaggactctggagaaaaacaaa
aagaaaggcaagatcttttaa

DBGET integrated database retrieval system