KEGG   Seriola dumerili (greater amberjack): 111237050Help
Entry
111237050         CDS       T05606                                 

Definition
(RefSeq) tankyrase-2-like
  KO
K10799  tankyrase [EC:2.4.2.30]
Organism
sdu  Seriola dumerili (greater amberjack)
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sdu03032]
    111237050
   03036 Chromosome and associated proteins [BR:sdu03036]
    111237050
Enzymes [BR:sdu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     111237050
DNA replication proteins [BR:sdu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     111237050
Chromosome and associated proteins [BR:sdu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     111237050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_5 Ank Ank_2 Ank_4 Ank_3 PARP SAM_2 SAM_1
Motif
Other DBs
NCBI-GeneID: 111237050
NCBI-ProteinID: XP_022621729
Position
Unknown
AA seq 1241 aa AA seqDB search
MASVAAGFWGSATCCSHSKLSRTSSLKLGRGRSPSSMLSGRRCSGVSGLGGGAVSPGPVV
AEVAVDPSSGGGGGRSGAGEASRELFEACRSGDLERVRKMVMAENVNSRDTAGRKSTPLH
FAAGFGRKDVVDFLLQNGANVHARDDGGLISLHNACSFGHAEVVSLLLHHGADANARDNW
NYTPLHEAAIKGKIDVCIVLLQHGAEPTIRNTDGRTALDLAELSTKAVLTGEYRKDELLE
SARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKTVQLLLQHGADVHAKDKG
DLVPLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADP
TFLNCHNKSSIDLAPTSQLKERLAYEFRGHSLLQAAREADAVRVKKHLSLETINFKHPLT
QETALHCVSASPYTKRKQVCELLLRKGANVNEKTKDLLTPLHLASEKGHNDVIEVLVKHE
AKVNAVDHLGQTALHRAAHCGHLQTCRLLLNAGGDPLLTSLQGLSPSQLGNKSVQEILQE
GVLIGNSEVDRQLLEASKTGDLETVKKLCTVQNVNCRDVEGRQSTPLHFAAGYNRLAVVQ
FLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVLHGAVVNVADLWKFTPLHEAAAKG
KYDICKLLLQHGADPTRKNRDGNTPLDLVKDADTDIQDLLRGDAALLDAAKKGCLARVKK
LCTHDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGAEVNSQDKGGLIPLHNAASYG
HVDVAALLIKYDACVNATDKWAFTPLHEASQKGRTQLCALLLAHGADPTLRNQEGQSPLD
LVTADDVRALLTAAMPPSALPGCYKPQVISVAAAASASSSPPIAVVSPLLSSSSPSTSSS
SSCPAPPVLLLPSSSSSSSSSGLDATTSATTGAGEGSVSAEKKEQVPGVELSIRQFLKNL
GLEHLLEIFDREQITLDVLVEMGHRELKEIGINAYGHRHKIIKGVERLISGPQSLNPYLT
LNTANSGTILIDLAADDKEFQSVEEEMQSTIREHRDGGHAGGVFNRYNLVKIQKVCNKKL
WERYTHRRKEVSEENHNHSNERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENS
SKSNQYVHGIGGGTGCPLHKDRSCYVCHRHLLFCRVTLGKSFLQFSAMKMAHSPPGHHSV
TGRPSVNGLALAEYVIYRGEQAYPEYLITYEIMRPDSPADG
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atggcctcagtggctgcagggttctggggttcggccacctgctgctctcactccaaactc
tccagaaccagcagcctgaaactgggccgaggccgttcgccatcgtccatgttgtccggc
cggaggtgttcaggagtgtccggtctcgggggtggagccgtgtccccggggcccgtggtg
gcagaggtggcggtggatcccagtagtggtggcggcggcggcaggtcaggggccggagag
gccagcagggagctgtttgaggcctgtcgcagcggggacctggagagagttcgtaaaatg
gtgatggctgagaacgtgaacagtcgggacacggcggggaggaagtccacgccactgcac
ttcgctgcaggttttggtcgtaaagacgtggtggacttcctcctccagaacggagccaat
gtccacgccagggacgacggagggctgatttccctccacaacgcctgctccttcggccac
gctgaggtggtgagtttgttgcttcatcatggcgcggacgcaaacgccagagacaactgg
aactacactccgcttcatgaggcagccatcaagggcaagatcgacgtgtgtatagtgttg
ctgcagcacggagccgagccgaccatcaggaacacagacggtcgaactgctctggatctg
gcagaactctccaccaaagcagtgctgacaggtgaatacagaaaagatgagcttctggag
agcgccaggagcgggaacgaggagaagctgatggctctgctgacgccgctcaatgtcaac
tgtcacgccagtgatggacgaaagtcgacgcccttgcacctggcggccggatacaaccgg
gtcaagacagtccagctgttactgcagcacggcgctgacgtgcacgccaaggacaagggg
gacctggttcctcttcataacgcctgttcatacggtcactatgaggtcactgagctgctg
gtgaagcacggagcctgtgttaacgccatggacctgtggcagttcactcctctacatgaa
gctgcttccaagaaccgagtggaggtgtgttctctcctgctgagctacggagctgacccc
accttcctgaactgtcacaataaaagctccattgacctcgccccgacctctcagctgaaa
gagcggctcgcctatgagttcagaggtcacagcctgctgcaggcggcccgggaggccgac
gcggttcgagtcaagaagcatctgagcctggagaccatcaacttcaaacacccgctcact
caggagacggccctgcattgtgtgtctgcctctccgtacacgaagaggaaacaagtgtgt
gaacttctgctgaggaaaggagccaacgtcaacgagaaaacgaaggacctgctgactcct
ctccacctggcgtcagagaaaggccacaacgacgtcatcgaggtgttggtcaaacacgaa
gccaaggtgaacgcggtggatcacctgggtcagacggcgttgcaccgggccgctcactgc
ggacacctgcagacctgcaggctgctgctgaacgccggcggtgacccgctgctcacgtcg
ctgcagggcctctctccctcacagctgggcaacaagagcgtgcaggagatactgcaagag
ggagttctcatcgggaactcggaggtcgaccgtcagctgctggaagcctccaaaactgga
gatctggaaactgtcaagaagctctgtacggtgcagaatgtgaattgcagggacgtggag
ggtcgacagtcgacgccgctgcatttcgccgccggctacaaccgtctggctgtcgtccag
ttcctgctgcagcacggagccgacgtgcacgccaaggataaaggaggtctggtcccgctc
cataacgcctgctcgtacggtcactatgaggtggcggagctgctggttcttcacggagcc
gtggtcaacgtggccgacctctggaagttcactccgctgcacgaagccgccgccaagggc
aaatacgacatctgtaaactcctgctgcagcacggcgccgacccgacccggaagaaccgg
gacggtaacacccccctggacctggtgaaggacgccgacacggacatccaggacctgctg
cggggcgacgccgccctgctggacgccgccaagaagggctgcctggctcgagtgaaaaaa
ctctgcacacacgacaacgtgaactgtagagacacacaggggagacactccacaccactg
cacctggctgcgggctacaataacctggaggtggctgagtacctgctgcagcacggagct
gaggtcaactctcaggacaaaggaggactgattcctctgcacaacgctgcctcctacggg
cacgtggacgtggcggctctcctcatcaagtatgacgcctgcgtcaacgccaccgacaag
tgggcgttcacgccgctgcacgaggcctctcagaagggccggacgcagctgtgtgcgctc
ctactggctcacggtgctgaccccaccctccggaaccaggagggccagtctcctctggac
ctggtcacggctgatgatgtcagggccttgctgacagcggcgatgcctccctctgctctc
cctggttgttataaacctcaggtcatcagcgtggcggctgcagcgtcggcctctagttct
ccacccattgctgtcgtctcgccacttctctcctcttcctccccctccacctcttcctca
tcctcctgccctgcccctcctgtcctcctcctcccctcttcctcttcctcctcttcctct
tctggtctggacgccaccacatcagctacgacaggcgccggcgagggatcagtgagcgct
gagaagaaagagcaagttccaggggttgagctcagtatccgtcagttcctgaagaacctg
ggtctggagcatcttctggagatctttgacagagagcagatcactctggatgtgctggtg
gagatgggtcaccgcgagctgaaggagatcggcatcaacgcctacggacacagacacaag
atcatcaaaggagtggagagactcatcagcgggccacagagtctgaacccttatctcacg
ttgaacacagccaacagtggaaccatcctgatcgacctcgcagccgacgacaaggagttt
cagtctgtagaggaggagatgcagagtacgatcagagagcacagagacggcggccatgct
ggaggagtgttcaacagatacaacctggtcaagatccagaaggtctgcaacaagaagctg
tgggagcgctacacccaccgcaggaaggaggtgtctgaggagaaccacaaccactccaac
gagcgcatgctgttccacggctccccgttcgtcaacgccatcatccacaaagggtttgac
gagcgccacgcctacatcggcgggatgttcggtgccggtatttactttgccgagaactcg
tcgaagagtaaccagtacgtacacgggattggaggggggacgggctgcccgctgcacaaa
gaccgctcctgctacgtctgccacagacacctgttgttctgcagggtgactcttggtaaa
tcctttctgcagttcagcgccatgaagatggctcactcgccgccgggtcaccactcggtg
accggcaggccgagcgtcaacggcctcgccctcgccgagtacgtcatctacagaggagag
caggcctatccagaatacctgatcacctacgagatcatgaggccggactctcctgcagac
ggatga

DBGET integrated database retrieval system