KEGG   Seriola dumerili (greater amberjack): 111237740
Entry
111237740         CDS       T05606                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
sdu  Seriola dumerili (greater amberjack)
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sdu01002]
    111237740
Enzymes [BR:sdu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     111237740
Peptidases and inhibitors [BR:sdu01002]
 Metallo peptidases
  Family M1
   111237740
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 111237740
NCBI-ProteinID: XP_022622671
Position
Unknown
AA seq 940 aa
MFVAPLLLLLFGPFAPSSGAQLPNEGQAKDPPIATNGQPFPWDRMRLPKTVSPIHYDLII
HPNLTTFDFTGVARIELDVHEDTSVIILHAKQMQISNVLLLAPEGVRPLQVLENPRFHQL
ALLSDSVLTKGRKYEVQLGFAANLSDSYHGFYKSSYRTSTGEVRFMASTQFEATFARGAF
PCFDEPAFKANFTIRITREPRHIAISNMPKVKTVELXRRLLEDNFDTTVKMSTYLVAYIV
SDFLSVSKTTQHGVKISIYAVPEKIDQTAFALDAAVKLLDFYDDYFDIPYPLPKQDLAAI
PDFQSGAMENWGLTTYRETGLLFDADRSSASDKLGITKVIAHELAHQWFGNLVTMEWWND
LWLNEGFAKFMEYISLDITYPELHVDDFFLGKCFEAMEVDSLSSSHPVSTPVENPMQIQE
MFDDVSYDKGACILNMLRDFLTPEAFEIGIIQYLKRYSYQNTVNSHLWESLTNICDSDDL
DEGRMKHKEFCSKRHVPSGASKWYSDDELDVRAIMDTWTLQEGFPLVTVEVRGREVRLSQ
ERYLKTDDPSLTEGFLWQIPLTYMTSASSTIHRFLLKTKTDVLYLPEEVDWVKFNVDMSG
YYMVHYADNGWNSIIRLLQHNHTALTSNDRASLIHTVFQLVSIGKVRLDTALELSLYLSR
ETEIMAVTQGFGELVPLYKLMEKRDMPALENQMKGYIVDLFRGLIDRQEWSDSGSVSERV
LRSYLLLFACVRNYTPCVTKATQLFNQWKASDGKISLPVDITMAVFVIGARTPEGWNFLF
EKYRNSMQMSVKSRMKTAMTVTPLQDKLKWMMEQSLRGDVMKTQDLPDVVVSVSRNPHGF
KLAWDFLRANWHTLIKKFDLGSSTISYMVTGVTNQYSTREMLNEVRSFFGSLTEETGSEM
RCIQQTYETIEDNIRWMDTNLPLLRAWLDKHRHKGPHEDL
NT seq 2823 nt   +upstreamnt  +downstreamnt
atgtttgtggctcctctcctgctgctgctgttcggtcccttcgctccctcatctggagca
cagctgccaaatgaaggccaagccaaagacccccccatagctaccaacggccagccattc
ccctgggatcgcatgcgacttcccaaaaccgtctcccccatccactacgacctgatcatc
caccccaacctgaccaccttcgacttcaccggcgttgctcgtattgagttggatgtgcat
gaagacaccagcgtcatcattctccatgccaagcagatgcagatctccaatgtgctgctc
ctggcacctgaaggtgtgaggcctcttcaggtgttggagaatcctcgtttccatcagctc
gccctgctgtcagactccgtgctgactaaagggaggaagtatgaagttcagctggggttt
gctgccaacttatctgacagctaccatggtttctacaaaagcagctaccgcaccagcact
ggggaagtccggttcatggcctccacacagtttgaggcgacctttgctcgtggagccttc
ccctgttttgatgagcctgccttcaaagccaacttcaccatacggattacacgagagcca
cgccacatagccatatccaacatgcctaaggttaaaacagtggagttgnccaggcgcttg
ctagaggataacttcgacaccactgtaaagatgagcacttacctggtggcctacattgtg
tctgatttcctgtctgtgagcaagacgactcagcacggcgtcaagatttcaatctatgct
gtacctgagaagattgaccagacagcatttgcactggatgctgctgtgaagctgttggac
ttctatgacgactactttgatattccttacccacttcccaaacaggacctggctgctatc
cctgacttccagtcaggtgcgatggagaactgggggctgaccacctacagagagacgggc
ctcctcttcgacgccgacaggtcttcagcttcagacaaacttggcatcaccaaggtcatc
gcccatgagcttgcacaccagtggtttgggaacctggtgacgatggagtggtggaatgac
ctgtggctcaacgagggtttcgccaagttcatggagtatatttctctcgacatcacctac
ccagagctgcatgtggatgacttcttcttggggaaatgttttgaggccatggaggtagac
tccctcagctcctcccacccagtctccacccccgtggaaaaccccatgcagatccaggag
atgttcgatgatgtgtcttatgacaagggagcatgtattctgaatatgctgcgggacttc
ctgactccagaggcctttgagatcggcatcatccaatacctgaaacgctacagctaccaa
aacactgtcaacagccacctgtgggagagcctgactaatatctgcgactcagatgatctg
gacgaaggccgaatgaaacacaaagaattctgctccaaacgccacgtcccgtctggagcc
tctaagtggtactctgatgatgagctggacgtcagggccatcatggacacctggacactg
caggagggcttcccgctggtcactgtagaggtcagaggtcgggaggtcagactcagtcag
gagcgttacctgaagacagatgacccctccctcactgaaggattcctgtggcagattcca
ctgacgtacatgaccagcgcctccagcaccatccaccgcttcctgcttaaaacaaagact
gacgtgctttacctgccggaagaggtggactgggtgaagttcaatgtggacatgagcggc
tactacatggtccactacgcagacaacgggtggaactccattatcagactgctgcaacac
aaccacacggccctgaccagcaacgatcgtgccagcctcatccacaccgtcttccagctg
gtcagcatagggaaggtgaggttggacacggctctggagctgtctctgtacctgtccaga
gagactgagatcatggctgtgactcagggctttggagagctcgtacctctctacaaactg
atggagaagagggacatgccggctctggagaaccagatgaagggctacattgtggatctg
ttcagggggctgattgatcggcaggagtggtctgactccggatcagtgtctgagcgagtg
ctcaggagttacctgctgctgttcgcctgtgtaaggaactacactccctgtgtgaccaaa
gccacccagctctttaaccagtggaaggcctctgatggcaaaatcagcctccctgtcgac
atcacaatggctgtgtttgtgattggagctcgaacaccagaggggtggaacttcttgttt
gagaagtaccgcaattcgatgcaaatgtctgtcaagagccgcatgaaaactgccatgact
gtcacccccctgcaggacaagctcaagtggatgatggagcagagcctccgcggtgatgtg
atgaagactcaggacctcccagacgtggtcgtctcagtcagcagaaacccccatggcttc
aaactggcctgggacttcctccgagccaactggcacaccctgatcaagaagttcgacctc
ggctccagcactatatcatacatggtgactggggtgaccaaccagtattctacccgggag
atgttaaatgaggtacgaagcttcttcggctccctgaccgaggagacgggctcggagatg
aggtgtatccagcagacatatgagaccattgaggataacatccgctggatggacaccaac
cttcctctgctgcgggcctggctggacaaacacagacacaaagggcctcatgaggattta
tag

DBGET integrated database retrieval system