KEGG   Seriola dumerili (greater amberjack): 111237959Help
Entry
111237959         CDS       T05606                                 

Definition
(RefSeq) TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04010  MAPK signaling pathway
sdu04060  Cytokine-cytokine receptor interaction
sdu04068  FoxO signaling pathway
sdu04144  Endocytosis
sdu04218  Cellular senescence
sdu04350  TGF-beta signaling pathway
sdu04520  Adherens junction
sdu04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111237959
   04350 TGF-beta signaling pathway
    111237959
   04068 FoxO signaling pathway
    111237959
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111237959
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111237959
  09143 Cell growth and death
   04218 Cellular senescence
    111237959
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111237959
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111237959
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sdu01001]
    111237959
Enzymes [BR:sdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     111237959
Protein kinases [BR:sdu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   111237959
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ecTbetaR2 Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 111237959
NCBI-ProteinID: XP_022623007
Position
Unknown
AA seq 663 aa AA seqDB search
MMARCWTFWTGILVLMTAGLPGVVQSFSHLSFNLCKWCEVSSPVCKDSVCMSNCTLSSFC
TVIEEICIAIWRKTNDTMTVHTMCHHPALPLEGVDPGLLLNFTSRECHMVPQPAEDGAMM
VCGCQGEHECNDKLIFNKGANGFFKLQSKDVIPVVVVSLVPPLLVAIVATAAFYFYRTHR
PDKPGPPARPNWPTKRTPELYQALDLPCGGRGSEGRGGGGGVMAPGSQLEESNAKVSSLN
NDISDITDWQGQLAEPLPIKLEALVGKGRFAEVWRARLLQGEKGGVNSYETVAVKVFPAV
EYASWRNECSIFSDPKLEHDNVVQFLAAEERGLPGHTLRKYWLVLAYYSLGNLQDFLTAN
ILSWEELVVMAGSIAKGLAHLHSDTTPGGIPKVPVAHRDLKSSNIVVKSRKECALCDFGL
ALRLDLSLTVDDYANSGQVGTARYMAPEVLESRVNLEDLEAFKQMDVYSMALVLWEMASR
CHAIGEVESYEPAFGSKVCEQPCVDSMRDLVLRDRGRPDIPSAWTQHQGMSIFCSTITEC
WDHDPEARLTAHCVVERFNALQQEQEQEQEQEQEQEQDQDQDQVQDQDQDQDQELRPEVG
RPEDEERAKNSEKPDNDQVHSSSTAASSPSSSSSPQVPKPQRDGTEVSHDSPVHTGTGCD
LLL
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgatggctcggtgctggacgttttggaccgggatcctagtcctcatgaccgccggtctt
ccaggtgtcgtccagtctttcagccacctgagcttcaacctgtgtaagtggtgtgaggtg
tccagtccggtgtgtaaagacagcgtctgcatgagtaactgcaccctgtcgtccttctgc
accgtcatcgaggagatctgcatcgccatatggaggaagaccaacgacacaatgacggtg
cacacgatgtgtcatcatcccgctctgccactagagggcgtcgaccccggcctgctgctc
aacttcacctccagagagtgtcacatggtcccacagccggcagaggacggagccatgatg
gtctgtggctgccagggagaacacgaatgtaacgacaaactgatcttcaacaagggagcc
aacgggttcttcaagctgcagagtaaagacgtgatcccggtggtcgtggttagtttggtg
cctcctctccttgttgccatagttgccaccgccgccttctatttctaccgcacacaccgc
cctgacaaacctggccctcctgcacgccccaactggcccaccaaacgcaccccagagctc
taccaggctttggacctgccatgtggaggccgggggtcggagggcagaggaggaggagga
ggtgtgatggctcctggatctcagctggaggagtctaatgccaaggtgtcatctctcaac
aatgacatcagtgacatcacagattggcaaggccaattggctgaaccgctgcccatcaaa
ctggaagccctggtggggaaggggcgcttcgctgaagtgtggagggcgcgcctgctgcag
ggcgagaagggcggggttaacagctatgaaactgtggcagtgaaggtgtttcccgctgtg
gagtacgcctcgtggagaaatgaatgctccatcttctccgaccccaaactggagcacgac
aacgtggttcagttcctggcggctgaggagaggggtctgcccggtcacactctccggaag
tactggctggtcttggcctattacagcctcggcaacctgcaggacttcctcacagcaaac
atcctgagctgggaggagcttgttgtcatggcaggcagcatcgctaaagggttagcgcat
ctccacagtgacacgacacccggcgggataccaaaggtgccagtcgcccatcgggacctg
aagagcagtaacatcgtggtgaagagcaggaaggagtgcgctctatgtgactttggtctg
gccttgagattggacctctcactcactgtcgatgactacgccaacagtggacaggtggga
acagctcgctacatggctcccgaggtactagagtccagggtgaacctggaggacctcgag
gcctttaaacagatggacgtttactccatggctctggtcctctgggaaatggcctctcgc
tgccacgcaatcggagaggtggagagctacgagccggcgtttggctctaaggtctgtgag
cagccctgtgtggacagtatgagagacctggtgctgagggacagaggacgtcctgacatc
ccctcagcctggacgcagcatcaggggatgagcatcttctgctccaccatcactgagtgc
tgggatcacgacccggaggccagactgacggctcactgtgtggtggagcgcttcaacgcc
ctgcagcaggagcaggagcaggagcaggagcaggagcaggagcaggagcaggaccaggac
caggaccaggtccaggaccaggaccaagaccaggaccaggaactgagaccagaagttggc
agaccggaggacgaagaaagagcaaagaactcggagaaaccagacaatgaccaggttcac
tcctcctccactgctgcttcctcaccctcctcctcttcctccccccaggttcctaagcca
cagagagacggtacagaggtatcccatgattctccggttcacactggtactggttgtgac
ctgttactgtaa

DBGET integrated database retrieval system