KEGG   Seriola dumerili (greater amberjack): 111239306Help
Entry
111239306         CDS       T05606                                 

Definition
(RefSeq) tankyrase-1-like
  KO
K10799  tankyrase [EC:2.4.2.30]
Organism
sdu  Seriola dumerili (greater amberjack)
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sdu03032]
    111239306
   03036 Chromosome and associated proteins [BR:sdu03036]
    111239306
Enzymes [BR:sdu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     111239306
DNA replication proteins [BR:sdu03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     111239306
Chromosome and associated proteins [BR:sdu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     111239306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 Ank Ank_4 Ank_3
Motif
Other DBs
NCBI-GeneID: 111239306
NCBI-ProteinID: XP_022624873
Position
Unknown
AA seq 652 aa AA seqDB search
MVGLAAALATLVVIQCQGSVPKNQETSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAG
YNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTP
LHEAASKNRVEVCSLLLSHGADPTLLNCHSKSSVDMAPTPELKERLTYEFKGHSLLQAAR
EADMAKAKKTLALEIINFKHPHTHETALHCAVASPHPKRKQVTELLLRKGANVNEKNKDF
MTPLHVAAERAHNDIMEVLQKHGAKVNALDTLGQTALHRAALAGHLQTCRLLLGYGADAS
LVSLQGFTAAQMGNEAVQQILNENVPVRNSDVDYRLLEAAKAGDLDTVKSLCTAQNVNCR
DLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVR
HGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKDGDTDIQ
DLLRGDAALLDAAKKGCLARVQKLCSPDNINCRDTQGRNSTPLHLAAGYNNLEVAEYLLE
HGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQL
CALLLAHGADPTMKNQEGQTPLDLATMWNLKLPARLTQDQVQCGSLMISEHC
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atggttggattggccgctgccttggcgacacttgtggtcatccagtgccagggcagcgtg
cctaagaaccaggaaacgagtgggaacgaggagaagctaatggctttgctcactccgctc
aacgtcaactgccacgcaagcgacggccgtaagtccaccccactccacctggcagcagga
tacaacagggtgaggatagttcagctgttactacagcatggagcagatgtccacgccaag
gacaaaggtggtctggtgcctctacataatgcctgctcctatggacactatgaagttact
gagcttctgctaaagcacggagcgtgtgttaatgccatggatctgtggcagttcaccccg
ctccacgaagcggcgtctaaaaaccgagtggaggtctgctctctgctgctgagccacggg
gccgacccgaccctgctcaactgccacagcaagagctccgtggacatggcgcccactcct
gagctgaaggagagacttacatatgagtttaagggccactcgctgcttcaagctgctcga
gaagctgacatggccaaggctaagaagaccctggcactggagatcatcaacttcaaacac
cctcacacacatgagaccgcactgcactgtgcagtagcatcacctcaccccaaaaggaaa
caggtgacggagctgctgttgaggaaaggcgccaatgtcaatgagaagaataaagatttc
atgactcctctccatgtggcagcagagcgggctcataatgacattatggaggtgctacag
aaacatggtgccaaggtgaacgcactggacactctgggtcagacggcattgcaccgcgct
gcgctggcaggccatctgcagacttgcaggttgttgctaggatacggggcagacgcctcg
ctggtgtcactgcagggctttactgctgctcaaatgggaaatgaagctgttcagcaaata
ctcaacgagaacgtcccggtgagaaactccgatgtggactacagacttcttgaagctgct
aaagccggagacctggacaccgtcaagtcactgtgtacggctcagaatgtgaattgcaga
gatctggagggacgacactccacgcctcttcactttgctgctggctacaacagagtgtca
gtggtggagtacctcctgcaccacggggccgacgtgcacgccaaggacaaaggcggtctg
gttcccctccataacgcctgttcgtacggtcactacgaggtggccgagctgctggtcaga
cacggagcctcagtcaatgtggccgacttgtggaagttcacgccgctccatgaagctgct
gccaagggcaaatatgagatctgcaaactgctgctcaagcacggagcggaccccaccaag
aagaaccgagacgggaacacgcctctggacctggtgaaggatggcgacaccgatatccag
gacctgctgagaggagatgctgcactgctggacgctgctaagaaaggctgcctggccagg
gtgcagaagttatgcagccccgacaacatcaactgtcgggatacgcagggacgcaactcc
accccgctgcacctggcagctggctataacaatttggaggtagcagagtatctgttggaa
catggagccgatgtgaatgcgcaggacaaaggagggcttatacctttacacaatgctgct
tcatacgggcacgtggacatagccgccctgctgatcaagtacaacacatgcgtcaacgcc
acagacaagtgggcgtttaccccccttcacgaagcggcccagaaggggcggactcagctc
tgcgccctgctactggcccatggagccgatccaactatgaagaaccaggagggacagacg
ccgctggacttggcaacgatgtggaatctgaagctcccagcacgattaacacaggatcag
gttcaatgtggatcgctgatgatatcagagcactgctga

DBGET integrated database retrieval system