KEGG   Seriola dumerili (greater amberjack): 111239543
Entry
111239543         CDS       T05606                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu00230  Purine metabolism
sdu00240  Pyrimidine metabolism
sdu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111239543
   00240 Pyrimidine metabolism
    111239543
Enzymes [BR:sdu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     111239543
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_17 AAA_28
Other DBs
NCBI-GeneID: 111239543
NCBI-ProteinID: XP_022625159
Position
Unknown
AA seq 266 aa
MATPPKRQFRASPLLSGSFSRRQKKISIEGNIAAGKSTFVRLLQGASEDWEVIPEPIGKW
CNVQNDSNDIYKELSSSQKSGGNLLQMLYDKPSCWSYTFQSYACLSRVRSQLQSPSVKLQ
QAENPVQFYERSVYSDRYVFASNLFECGNLSDTEWAVYQDWHTWLLNQFEPEIALDGIIY
LRAQPQRCMQRLLHRGREEEQGIPLEYLQQLHFKHEAWLYHRNLRLDFDYLNDLPLLILD
VDDDFKNDRIKQEAIVDKVRDFLTTL
NT seq 801 nt   +upstreamnt  +downstreamnt
atggcgacaccaccgaagaggcaattccgtgccagtccgttactgagcggcagcttctca
cgcagacagaagaagatctccatcgagggaaacattgctgcagggaagtctacgtttgtg
cgtctcctccagggggcatcggaggactgggaagtgattcctgaacctattggaaaatgg
tgtaacgtccagaatgacagcaacgacatttacaaggagctgagttcctctcagaagagt
ggagggaacctgctgcagatgttgtatgataaacctagctgctggtcctacaccttccag
agttatgcgtgtctcagcagagttcgttctcagcttcagtctccgtcagtcaaacttcag
caggctgaaaaccctgttcagttctatgaacgctctgtttactcagacaggtacgtgttt
gcgtccaacctgtttgagtgtggtaacctgtcagacacagagtgggctgtttatcaggac
tggcacacctggttactgaaccagtttgaacctgagatcgccctcgacggaatcatctac
ctgagagcccagccacagcgctgtatgcagcggttgctccaccggggacgggaggaggaa
caggggattcctctggagtatctgcagcagctacacttcaaacatgaggcctggctctac
cacaggaacctcaggttggactttgattacctgaatgatctacctcttctgattctggac
gtcgacgacgacttcaagaatgatcgtatcaaacaggaagccattgtcgacaaggtcaga
gactttctcaccacgctgtag

DBGET integrated database retrieval system