KEGG   Seriola dumerili (greater amberjack): 111239651Help
Entry
111239651         CDS       T05606                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase-like
  KO
K09565  peptidyl-prolyl isomerase F (cyclophilin D) [EC:5.2.1.8]
Organism
sdu  Seriola dumerili (greater amberjack)
Pathway
sdu04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:sdu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    111239651
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sdu03110]
    111239651
Enzymes [BR:sdu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     111239651
Chaperones and folding catalysts [BR:sdu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    111239651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 111239651
NCBI-ProteinID: XP_022625263
Position
Unknown
AA seq 164 aa AA seqDB search
MGNPRVFFDMAIGESPVGRIVMELRADVVPKTAENFRALCTGEKGFGYKGSSFHRVIPGF
MCQGGDFTNHNGTGGKSIYGEKFADENFQLRHISTGTLSMANAGPNTNGSQFFICTAGTS
WLDGKHVVFGSVVEGIDVVKNIETFGSKSGKTREKVVIADCGEI
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaccccagagttttctttgacatggccattggagaatctcccgttggcaggatt
gtaatggagcttcgggctgatgtggtcccaaagactgcagaaaatttccgtgctttgtgc
accggagagaaaggttttggctacaagggctcctcgtttcaccgtgtcatccctggtttc
atgtgccagggtggggactttaccaaccacaatgggactggaggcaaatccatctatgga
gagaagtttgctgatgagaatttccagttgagacacatcagcacggggacactgtccatg
gccaatgctgggcccaacaccaacggatcccagttcttcatctgcacagcaggaacttcc
tggcttgacgggaagcacgtggtgtttggcagcgttgtggagggcattgatgttgttaag
aacatagaaacgtttggctcaaaaagcggcaagacaagagaaaaggttgtcattgctgac
tgtggtgaaatataa

DBGET integrated database retrieval system