KEGG   Streptomyces davaonensis: BN159_2499
Entry
BN159_2499        CDS       T02518                                 

Definition
(GenBank) acyl-CoA dehydrogenase
  KO
K14630  two-component flavin-dependent monooxygenase [EC:1.14.14.-]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv01057  Biosynthesis of type II polyketide products
sdv01100  Metabolic pathways
sdv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sdv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    BN159_2499
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:sdv01008]
    BN159_2499
Enzymes [BR:sdv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.-  
     BN159_2499
Polyketide biosynthesis proteins [BR:sdv01008]
 Polyketide tailoring proteins
  Oxygenase
   BN159_2499
SSDB
Motif
Pfam: Acyl-CoA_dh_2 Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Other DBs
NCBI-ProteinID: CCK26878
UniProt: K4R0N5
Position
2816974..2818077
AA seq 367 aa
MSGSLLSPTDTSGAVRQATELAARHASDADLARRLPGEVVDALVAAGFARHFVPARWGGR
AGGFTELLDSVSTVGEGCTSAAWIATVTAGAARMGACLPEEGQSELWSGGADTVVVGALN
PTGKAVPVAGGWRLTGQWPLVSGVDFADWTLVCAMAPRHEREEARFFAVPRHDYRVADTW
FNVGMRATGSNTLISDGAFVPEHRSVAREDIWRGRAVGSAARCHTAPLRSISGTLFAAPA
LGAARAAVRAWSARMVGRPGPAAQGVLARAEGDIEGAALLLHRVARTADDGTGDAHERTR
APRDCALAADHLVDAVERLFRSAGSGAQAEADPLQRIWRDVHCVASHAALRFETAGIAHG
GQLLGAG
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgtccggctcgttactctcccccaccgacacgtccggcgcggtacggcaggccaccgaa
ctggccgcccggcacgcctcggacgcggacctcgctcggcgactgcccggcgaggtggtg
gacgctctggtcgcggcggggttcgcccggcacttcgtgccggcccgctggggcggacgg
gccggcggtttcacggagttgctcgactcggtgtccacggtgggcgagggctgcacctcg
gccgcctggatcgccacggtcaccgccggggccgcccggatgggggcctgcctgccggag
gaaggacagagcgagctctggtcgggcggcgccgacaccgtcgtcgtgggagcgctcaac
cccaccgggaaggccgtgccggtcgccggcggctggcggctcaccggtcagtggccgctg
gtcagcggggtggacttcgccgactggacgctggtctgcgcgatggcaccccggcacgag
cgggaggaggcccggttcttcgccgtgccgcgccacgactaccgggtcgcggacacctgg
ttcaacgtcggcatgcgggcgaccggcagcaacaccctgatctcggacggggcgttcgtc
cccgagcaccggtccgtcgcgcgcgaggacatctggcgcgggcgggccgtcggctccgcc
gcgcgctgccacaccgcaccgctgcggtcgatcagcggcaccctgttcgccgcccccgcg
ctaggtgcggcccgcgcggccgtgcgggcctggtcggcgcgcatggtgggcaggccgggc
ccggcggcgcagggcgtactggcccgcgccgagggtgacatcgagggcgcggccctgctg
ctgcaccgggtggcgcgcaccgccgacgacggtaccggcgacgcgcacgagcgcacccgg
gcaccgcgggactgcgcgctggccgcggaccacctcgtcgacgcggtggagcggctcttc
cgctcggcgggctccggcgcccaggccgaggccgacccgctccagcggatctggcgcgat
gtgcactgcgtggccagccatgccgccctgcgcttcgagaccgcgggcatcgcgcacggc
ggtcagttgctgggcgccggctga

DBGET integrated database retrieval system