KEGG   Streptomyces davaonensis: BN159_4099Help
Entry
BN159_4099        CDS       T02518                                 

Gene name
pphA
Definition
(GenBank) Phosphonopyruvate hydrolase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00440  Phosphonate and phosphinate metabolism
sdv01100  Metabolic pathways
sdv01120  Microbial metabolism in diverse environments
sdv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BN159_4099 (pphA)
Enzymes [BR:sdv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BN159_4099 (pphA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL
Motif
Other DBs
NCBI-ProteinID: CCK28478
UniProt: K4R562
Position
4585919..4586854
Genome map
AA seq 311 aa AA seqDB search
MTGSRPPQQEPNDPPTGAAQRLRSALAAPRLTRAMGSHSPLSARLAEEAGFDVVWSSGLE
ISATAGVPDANILALGECLDAAAGLAAAVDIPVLADCDSGFGNVNNVIHMVRSYEARGVA
GVCIEDKQFPKLNSFIEGNQDLAPLDDFAGKIRAATETRTDMVVVARLEALISGQGMAEA
LRRADVYERAGADALLIHSKRKDPEEVFAFREAYHGGLPVIVVPTTYNQVTVEELEQRGF
AMAIYANQALRSSIRAMRETLTKIMRDGTTLNVEPELAPLKEIFDLQRMPQMLQQQERYE
SLGRELAEAAQ
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggagccgaccgccccagcaggaaccgaacgacccgccgaccggcgcggcacag
cggctgcgctcggcgctcgccgcaccgcgactgacacgtgccatgggctcgcacagcccg
ctcagcgcacggctcgccgaggaggccggcttcgacgtcgtctggtccagcgggctggag
atctcggccacggccggcgtgcccgacgccaacatcctcgccctgggcgaatgcctcgac
gcggccgccggcctcgcggccgccgtggacatcccggtcctcgcggactgcgactccggg
ttcggcaacgtcaacaacgtcatccacatggtgcgctcctacgaggcgcgcggcgtggcc
ggcgtgtgcatcgaggacaagcagttccccaagctcaacagcttcatcgagggcaaccag
gacctcgccccgctggacgacttcgcgggcaagatccgggccgccacggagacgcgtacc
gacatggtcgtggtcgcccggctggaggcgctgatctccgggcagggcatggcggaggca
ctgcgccgggccgacgtgtacgagcgggccggggcggacgccctgctcatccactccaag
cgcaaggaccccgaggaggtcttcgccttccgcgaggcctaccacggcggactcccggtg
atcgtcgtgccgaccacgtacaaccaggtcaccgtcgaggaactggagcagcgcggcttc
gccatggcgatctacgccaaccaggcgctgcgcagctcgatccgggccatgcgggagacc
ctcaccaagatcatgcgggacggcaccacgctgaacgtggagcccgaactcgccccgctc
aaggagatcttcgacctgcagcgcatgccccagatgcttcagcagcaggagcgctacgag
tccctgggacgcgaactcgcggaggccgcacagtga

DBGET integrated database retrieval system