KEGG   Streptomyces davaonensis: BN159_4211Help
Entry
BN159_4211        CDS       T02518                                 

Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00380  Tryptophan metabolism
sdv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BN159_4211
Enzymes [BR:sdv01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     BN159_4211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase
Motif
Other DBs
NCBI-ProteinID: CCK28590
UniProt: K4R679
Position
complement(4711649..4712488)
Genome map
AA seq 279 aa AA seqDB search
MSHEAHETQEPETPHLDFAGTTPYEDYVKADVLTHLQHTLSDDPGEMVFLVTTQVMELWF
TVVVHEWETAAHALREDRVPVAIDALKRSVRELEALNASWKPLGQLTPAQFNSYRSALGE
GSGFQSAMYRRMEFLLGEKSASMLVPHRGAPRVHAELEKALHEPSLYDEVLRLLSRRGHA
IPASVLHRDVSQRYEPSDAVEAAWTAVYSGDAGDEVARLGEALTDVGELVWRWRNDHLVA
TRRAMGSKAGTGGSAGVAWLEKRARKNVFPELWTARSHV
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacgaggctcacgaaacccaggagcccgagaccccgcatctcgacttcgcaggc
acgacgccgtacgaggactacgtcaaggcggacgtgctcacccacctccagcacaccctc
tccgacgatcccggagagatggtcttcctggtcaccacccaggtgatggagctgtggttc
accgtcgtcgtccatgagtgggagaccgccgcgcacgcgctgcgcgaggaccgggtgccg
gtcgcgatcgacgcgctgaagcgttcggtacgggagctggaggcgctgaacgcctcctgg
aagccgctcggccagctcaccccggcccagttcaactcctaccgctccgccctcggcgag
ggctccggcttccagtcggcgatgtaccggcggatggagttcctgctcggcgagaagtcc
gcgtccatgctcgtcccgcaccgcggcgcgccccgcgtccacgcggaactggagaaggcg
ctgcacgagccgagcctgtacgacgaggtgctgcggctgctgtcccggcgcgggcacgcg
atccccgcctccgtgctgcaccgtgacgtctcccagcgctacgagccctccgacgcggtc
gaggccgcctggaccgccgtctactccggggacgccggggacgaggtcgcccggctgggc
gaggcgctcacggacgtcggggagctggtgtggcgctggcgcaacgaccacctggtcgcc
acccgccgcgcgatgggctcgaaggcgggcacgggcggttccgccggggtggcctggctg
gagaagcgtgcccgcaagaacgtcttccccgagctgtggacggcgaggtcccatgtctga

DBGET integrated database retrieval system