KEGG   Streptomyces davaonensis: BN159_4232Help
Entry
BN159_4232        CDS       T02518                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00450  Selenocompound metabolism
sdv00970  Aminoacyl-tRNA biosynthesis
sdv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BN159_4232
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BN159_4232
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sdv01007]
    BN159_4232
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sdv03016]
    BN159_4232
Enzymes [BR:sdv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BN159_4232
Amino acid related enzymes [BR:sdv01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BN159_4232
Transfer RNA biogenesis [BR:sdv03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BN159_4232
 Prokaryotic type
   Other AARSs
    BN159_4232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: CCK28611
UniProt: K4QWZ6
Position
complement(4732830..4734386)
Genome map
AA seq 518 aa AA seqDB search
MSATTVIIAPPPTPNGNLHVGHIAGPYLAGDVHARYLRADGRPVIFTTGTDDSQTYVVAS
AAKLGTTPQDLCALSAKQIEHTLGVMGISIDGFAPFDDGYRQTALDFLTELHAAGRLRLR
TGTFPYLERTGEFLMEGLVAGDCPVCLAESRGGLCESCGHPNNFAELINPRSTIDPTEPV
AFREAEILVLPMEEYRDQLAAYHENQGAGWRPNLVQLFKEVLSRPLPDFPITFPTGWGIP
APFPETPGQVLNAWAEGMAASMYCTWWAAGDRAAATDEAWRAEHSAKLVYFLGFDNGYFW
GGTHLALLMAHNGKYILPDTIVCNEFYELEHEKFSTSKGHVVWAEDLVNEVPRDLIRFYL
SLTCPENQRTNFSRAAFEQITSERLVTPWNLLSERLGKRLDDVRPAGPLPTSAEGRARAA
AMEERFRTCYELSSYSLARAADLIISQVQRLSRDAADAEPGDLLLETRTLLSCAAPILID
VAEQAREAGVALGLHGEPADEIPPFRLPLIATPLRTTS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccaccacggtcatcatcgcgccgcctcccacacccaacggaaacctgcacgtc
ggacacatcgcgggtccctatctggccggtgacgtgcacgcccgttacctgcgcgccgac
ggtcggccggtgatcttcaccaccggtacggacgacagtcagacgtacgtggtcgcgagc
gccgcgaaactcggcaccaccccacaggacctctgcgcgctgtccgccaagcagatcgag
cacacgctcggcgtgatgggcatctccatcgatggattcgccccgttcgacgacggctat
cggcagacggccctggacttcctgaccgaactgcatgccgccggtcgactgcgcctgcgc
accggcacgttcccgtatctggaacgcaccggtgaattcctgatggagggccttgtcgcc
ggcgactgcccggtctgcctggccgagagccggggcggtctctgcgagtcgtgcggtcac
ccgaacaacttcgcggagctgatcaacccccgctccaccatcgaccccaccgagcccgtg
gccttccgcgaggcggagatcctggtacttcccatggaggagtaccgcgatcagctcgcc
gcctaccacgagaaccagggcgcgggctggcggccaaatctcgtgcagctgttcaaggaa
gtgctgtcccggcccctgccggacttccccatcaccttcccgacgggatggggcatcccg
gctccgttccccgagacgcccgggcaggtgctcaacgcatgggccgagggcatggccgcg
tcgatgtactgcacctggtgggccgccggtgaccgggcggcggcgacggacgaggcatgg
cgggccgagcactccgccaagctcgtgtacttcctcggctttgacaacggctacttctgg
ggcggcacgcacctcgcgctgctgatggcgcacaacggcaagtacatcctgcccgacacc
atcgtctgcaacgagttctacgagctcgagcacgagaagttctcgaccagcaagggtcat
gtggtgtgggccgaggatctcgtcaacgaggtgcctcgagacctgatccgcttctacctc
tcgctgacctgccccgagaaccagcgcacgaacttcagcagggcggcgttcgagcagatc
acgtccgaacgcctggtcaccccgtggaatctgctgtccgagcggttgggcaagcgcctc
gacgatgtccggcccgccggaccgctgccgacctccgccgagggaagggcccgcgccgcg
gcgatggaggaaaggttccgtacgtgctacgagctgtcctcgtacagccttgcccgtgcc
gcggacctgatcatctcccaggtgcagcgactgagccgcgacgcggccgacgccgaaccg
ggcgaccttctgctcgaaacccggacgctgctgtcctgcgccgcacccatcctcatcgac
gtggccgagcaggcccgtgaggccggggtcgctctgggccttcacggcgaacccgccgac
gagatcccgccgttccggctgccgctgatcgcaacccccctgaggaccacatcatga

DBGET integrated database retrieval system