KEGG   Streptomyces davaonensis: BN159_4406Help
Entry
BN159_4406        CDS       T02518                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00010  Glycolysis / Gluconeogenesis
sdv00020  Citrate cycle (TCA cycle)
sdv00620  Pyruvate metabolism
sdv01100  Metabolic pathways
sdv01110  Biosynthesis of secondary metabolites
sdv01120  Microbial metabolism in diverse environments
sdv01130  Biosynthesis of antibiotics
sdv01200  Carbon metabolism
Module
sdv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sdv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN159_4406
   00020 Citrate cycle (TCA cycle)
    BN159_4406
   00620 Pyruvate metabolism
    BN159_4406
Enzymes [BR:sdv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BN159_4406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: CCK28785
UniProt: K4R6S6
Position
complement(4915968..4917305)
Genome map
AA seq 445 aa AA seqDB search
MAQVLEFKLPDLGEGLTEAEIVRWLVQVGDVVAVDQPVVEVETAKAMVDVPCPYAGVVTA
RFGEEGSELPVGAPLITVAVGAPASDSEAAGSGNVLVGYGTSEAPARRRRVRPAQPTPPE
SVARPVGTAAGHRPADDTSSAVALTRADGPVPVISPLVRRLARENGLDLRELHGSGPEGL
ILRADVEYALRAAAAQGRTAQAPAPAPVTALAPVTVGETRTPLKGVRGAVADKLSRSRRE
IPDATCWVDADATELMRARTAMNAAGGSKISLLALLARICTAALARFPELNSTVDQEARE
IVRFDHVHLGFAAQTERGLVVPVVRDAHARDAESLTAEFARLTESARTGALTPAELTGGT
FTLNNYGVFGVDGSTPIINHPEAAMLGVGRIIPKPWVHEGELAVRQVVQLSLTFDHRVCD
GGTAGGFLRYVADCVEQPAVLLRTL
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggtgttggagttcaagctccccgacctcggcgaggggctcaccgaggcggag
atcgtgcgctggctggtccaggtcggcgatgtcgtcgccgtcgaccagccggtcgtcgag
gtcgagacggccaaggcgatggtcgacgtcccctgcccctacgccggtgtggtcaccgcc
cgcttcggcgaggagggctccgaactgcccgtgggcgccccgctgatcaccgtcgccgtg
ggcgccccggcctccgacagcgaggccgcgggctccggcaacgtcctggtgggctacggc
acctccgaggcccccgcgcgacgcaggcgggtacgccccgcgcagccgacgccgcccgag
agcgtggcgcggcccgtcggcaccgcggccgggcaccggcccgccgacgacacgtcatcg
gccgttgccctgacccgtgctgacggcccggtacccgtgatctccccgctggttcgccgc
ctcgcccgtgagaacggcctggacctgcgggagttgcacggctccggtccggaagggctg
atcctgcgcgcggacgtggagtacgccctgcgggccgccgccgcacagggacgcacagca
caggcccccgcccccgcacccgtcaccgccctcgcccccgtcaccgtcggcgagacccgc
acccctctcaagggcgtccgcggtgccgtggccgacaagctctcccgcagccggcgggag
atcccggacgcgacctgctgggtggacgccgacgcgaccgagctgatgcgcgcccgcacc
gcgatgaacgccgcggggggctcgaagatctccctcctggccctgctggcccgtatctgc
accgccgccctggccaggttcccggagctgaactccaccgtggaccaggaggcccgggag
atcgtccggttcgaccacgtccacctgggcttcgcggcccagaccgagcgcggcctggtc
gtgccggtcgtgcgcgacgcccacgcacgggacgcggagtcgctgaccgccgagttcgcc
cggctcaccgagtcggcccgcaccggcgccctgacaccggcggagctcaccggcggcacc
ttcacgctgaacaactacggtgtcttcggggtggacggctccacgccgatcatcaaccac
cccgaggcggccatgctcggcgtcggccggatcatccccaagccgtgggtgcacgagggc
gagctggccgtgcgccaggtcgtccagctctcgctcaccttcgaccaccgggtctgcgac
ggcggcacggcgggcggcttcctgcgctacgtggcggactgcgtggagcaaccggcggtg
ctgctgcgcaccctctga

DBGET integrated database retrieval system