KEGG   Streptomyces davaonensis: BN159_4599Help
Entry
BN159_4599        CDS       T02518                                 

Definition
(GenBank) Peroxidase
  KO
K15733  dye decolorizing peroxidase [EC:1.11.1.19]
Organism
sdv  Streptomyces davaonensis
Brite
KEGG Orthology (KO) [BR:sdv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BN159_4599
Enzymes [BR:sdv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.19  dye decolorizing peroxidase
     BN159_4599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dyp_perox
Motif
Other DBs
NCBI-ProteinID: CCK28978
UniProt: K4R6J5
Position
complement(5130371..5131612)
Genome map
AA seq 413 aa AA seqDB search
MADQSNPDTPTGVTRRALLGTAGATGLALGAAGGAVGYAAAPATATPLTSLGAQEAMFHG
KHQPGILQGLQARGHLIAFDLTAGAGRKEAAALLRRWSDTARRLMAGEPTGSGDTDVARD
AGPSALTVTFGFGHSFFARTGLEKQRPIALDPLPDFSSDRLDKARSNGDLWVQIGADDAL
VAFHALRALQKDAGQAAKVRWQMNGFNRSPGATAHPMTARNLMGQIDGTRNPKPAEPDFD
QRIFVPSSGEPSWMASGSYAVVRRIRMLLDDWEQLSGKEQENVIGRRKADGAPLSGGIET
TEMDLEKTDRTGEPVVPINAHARISRPDQNGGAAMLRRPFSFHDGIAADGTPDAGLLFVC
WQADPLRGFVTVQRKLDRGDALSKFIRHESSGLFAVPGGAAEGEYVGQRLLEA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccagtccaacccggacaccccgaccggtgtgacgcgccgcgccctcctcggc
accgccggcgccaccgggctcgcactcggcgcggcgggcggggccgtgggctatgccgcc
gcgcccgccaccgcgaccccactcacctcgctgggcgcccaggaggcgatgtttcacggg
aaacatcagcccggcatcctccagggcctccaggcccgcggccatctcatcgccttcgac
ctgacagcgggcgcgggccgcaaggaggccgccgcgctgctgcgccgctggtcggacacc
gcccgccgactgatggcgggcgaaccgacgggcagcggcgacaccgatgtggcgcgggac
gccggaccctccgcactgaccgtcaccttcggcttcggccacagcttcttcgcccgcacc
ggactggagaaacagcgcccgatcgccctcgacccgctgcccgacttctcctccgaccgc
ctcgacaaggcccgcagcaacggcgacctgtgggtgcagatcggcgcagacgacgcgctg
gtcgccttccacgccctgcgcgcgctccagaaggacgcgggacaggccgccaaggtgcgc
tggcagatgaacggcttcaaccgctcacccggtgccaccgcccaccccatgacggcccgc
aatctgatgggccagatcgacggcacccgcaaccccaagccggccgagcccgacttcgac
cagcggatcttcgtgccgtcctccggcgaaccgtcctggatggcgagcggctcctacgcc
gtcgtacgccgcatccgcatgctcctcgacgactgggagcagctctccggcaaggagcag
gagaacgtcatcggacgccgcaaggccgacggggcaccgctgtccgggggcatcgagacg
accgagatggacctggagaagacggacaggaccggggagccggtcgtcccgatcaacgcc
cacgcgcgcatctcccggcccgaccagaacggcggggcggcgatgctgcggcggccgttc
tccttccacgacggcatcgccgcggacgggaccccggacgcgggcctgctcttcgtgtgc
tggcaggcggaccccttgcgcggcttcgtgaccgtgcagcgcaagctcgaccggggcgac
gcgctgtcgaagttcatccgccacgagtccagcggcctgttcgcggtgccgggcggggca
gccgagggagagtacgtcggacagcggctgctggaggcgtga

DBGET integrated database retrieval system