KEGG   Streptomyces davaonensis: BN159_6313Help
Entry
BN159_6313        CDS       T02518                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
sdv  Streptomyces davaonensis
Brite
Enzymes [BR:sdv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BN159_6313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 UPF0227 Abhydrolase_5 Thioesterase BAAT_C DLH Abhydrolase_3 Esterase Tannase Lipase_3 Esterase_phd
Motif
Other DBs
NCBI-ProteinID: CCK30692
UniProt: K4RBK8
Position
complement(7091912..7092691)
Genome map
AA seq 259 aa AA seqDB search
MPVLPGAEPYRHEGGEISVLLCHGFTGSPQSLRPWAEYLAARGLTVSLPLLPGHGTRWED
LQLTGWQDWYAEVDRELRALRERSTHLFVAGLSMGGALALRLAAKHGDAVDGVVVVNPAN
KVHGLAAHALPVARHLVRTTKGIASDIAKEGSDEVGYDRVPLHAAHSLRNFFRRVDGELP
QVTQPLLLLHSTQDHVVPPADSARVLSRVSSTDVTEIVLEQSYHVATLDHDAERIFAESH
AFMSRLAPSLGKEGTAVGG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgccggtccttcctggagccgagccgtaccgccatgagggcggggagatctccgtactc
ctctgccacggcttcaccggttccccgcagtcgctgcgcccctgggcggagtatctcgcc
gcacgcggtctgaccgtctcgctgccgctgctgcccgggcacggcacccgctgggaggat
ctccagctcaccggctggcaggactggtacgcggaggtggaccgcgagctgcgcgccctg
cgggagcgctccacccacctcttcgtggccggtctgtccatgggcggtgccctggcgctc
cggctggcggcgaagcacggcgacgcggtggacggcgtggtggtcgtcaaccccgcgaac
aaggtgcacggcctggccgcgcacgcccttccggtggccaggcacctcgtgcggacgacg
aagggcatcgccagcgacatcgccaaggagggcagcgacgaggtcggctacgaccgggtg
ccgctgcacgccgcgcactccctgcggaacttcttccgccgggtcgacggcgagctgccg
caggtcacgcagccgctgctgcttctgcacagcactcaggaccatgtggtgccgcccgcc
gactcggcccgggtgctcagccgggtgtcgtcgacggacgtgacggagatcgtgctggaa
cagagctaccacgtggcgacgttggaccatgatgcggagcggatcttcgcggagagccac
gccttcatgagccggctcgcacccagtctcggcaaggaagggacggccgtaggtggctga

DBGET integrated database retrieval system