KEGG   Streptomyces davaonensis: BN159_6679Help
Entry
BN159_6679        CDS       T02518                                 

Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00051  Fructose and mannose metabolism
sdv01100  Metabolic pathways
sdv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sdv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BN159_6679
Enzymes [BR:sdv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BN159_6679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: CCK31058
UniProt: K4RBW9
Position
7494547..7495278
Genome map
AA seq 243 aa AA seqDB search
MAEQRGKRRGAGEAGESAREVREPWPDGVRPEEARAWEDLVATARRTVSEGLVVGTSGNV
SVRVGDTVLVTPSGVPYDRLTPEDITGVDLSGRQVLGTLRPTSELPMHLAVYGATDARAV
VHTHAVHATAVSTLVQEVPAIHYITADLGGPARVAPYATYGTEELAENMLRALTDRTACL
LQNHGTMTYGTTLSQAYDRTAQLEWMCRVWLTASSVPGLTPSLLSGEQLAEVQQKLRGYG
QPT
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcagcgagggaagcggcggggcgcgggggaagcgggggagagcgcacgggaa
gtgcgggagccgtggccggatggtgtacgtccggaggaggcgcgggcctgggaggacctg
gtcgccaccgcccgccggacggtctccgaggggctggtggtggggacctctggcaatgtc
tcggtgcgcgtcggggacacggtcctggtcacaccgtcgggagtgccgtacgaccggctc
acgcccgaggacatcacgggcgtcgacctctccggccgccaggtgctcggaacgctccgg
ccgaccagtgagctgccgatgcatctcgccgtctacggcgccaccgacgcccgcgccgtc
gtccacacccacgcggtgcatgccacggcggtctcgacgctggtccaggaggtcccggcg
atccactacatcaccgccgacctcggcggccccgcccgggttgccccgtatgcgacatac
ggcaccgaggagttggccgagaacatgctccgagccctgaccgaccgcaccgcctgccta
ctccagaaccacggcacgatgacctacggcacgaccctgtcccaggcctacgaccgcacg
gcgcagctggagtggatgtgccgagtgtggctgacggcatcttcggtgccgggcttgacg
ccgtcactgctgtcgggcgagcagctggccgaggtgcagcaaaagctccggggttacggt
cagcccacctag

DBGET integrated database retrieval system