KEGG   Streptomyces davaonensis: BN159_7136Help
Entry
BN159_7136        CDS       T02518                                 

Gene name
casA
Definition
(GenBank) Endoglucanase 1
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
sdv  Streptomyces davaonensis
Pathway
sdv00500  Starch and sucrose metabolism
sdv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN159_7136 (casA)
Enzymes [BR:sdv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BN159_7136 (casA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6
Motif
Other DBs
NCBI-ProteinID: CCK31515
UniProt: K4RDL4
Position
7991585..7992712
Genome map
AA seq 375 aa AA seqDB search
MVVAASVVVAVGTAAGMISAFDEGGGSDEARPDTTYSPRLETLPVEPPPSPSTSGSPSAE
PSPKRTKKKEASPTPSPTRTERRTTAVSTQLYRHPDSQVLDWVGANSGDPRHGVIQSRIA
AQPAAVWFADFTPDTITARVRAVTSGGAAQGRTPVVVAYAIPDRDCGGASQGGAPDLGAY
DDWIDRFAAGLGSGDVIVVLEPDSIAQSECLSGGQRADRFASLARAGRVLKDANPNARVY
YDAGHSGWHAPGKQAGWLKQAGAASSASSDGIFSNVSNFHTTAAEIAYDRQVLDALGGPA
SLGAVIDTSRNGNGAPADGEWCDPAGRALGRTPTLSTGEARIDGYLWVKLPGESDGCKGT
PGTFSASYAYDLASS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggccgcgtccgtcgtggtcgccgtcgggaccgcggccgggatgatctcggcg
ttcgacgaagggggcggctccgacgaggcccgccccgatacgacctactccccgcgcctt
gagaccctgccggtcgagccaccgccgtccccgtccacgtccgggtcgccctccgccgag
ccctcgccgaagaggacgaagaagaaggaggcgagcccgacgccctcgcccaccaggacc
gagcggcgcacgaccgccgtctccacccagctgtaccggcaccccgattcccaggtgctg
gactgggtcggcgcgaactccggcgatccccggcacggcgtcatccagtcccggatcgcc
gcccagcccgccgccgtgtggttcgccgacttcaccccggacaccatcaccgcccgggtc
cgcgcggtcacttcgggcggcgccgcccagggccggaccccggtggtcgtggcgtacgcg
atcccggaccgcgactgcggcggggccagccagggcggggcgcccgacctcggcgcctac
gacgactggatcgaccgcttcgccgcaggcctcggctccggcgatgtcatcgtggtcctc
gaacccgactccatagcccagtccgagtgcctttccggaggccaacgggccgaccgcttc
gcctcgttggcccgcgccggacgcgtcctgaaggacgccaaccccaacgcccgcgtctac
tacgacgccgggcactccggctggcacgcccccggcaagcaggcgggctggctgaagcag
gcgggcgccgcctcgtccgcctcctccgacgggatcttcagcaacgtctccaacttccac
accacggccgccgagatcgcctacgaccgacaggtcctcgacgccctcggcggccccgcc
tccctcggcgccgtcatcgacaccagccgcaacggcaacggcgccccggccgacggcgag
tggtgcgaccccgccggacgggcgctgggccggaccccgacgctcagcaccggcgaggcc
cgcatcgacggctatctgtgggtgaagctgccgggggagtccgacgggtgcaaggggacg
ccggggaccttctccgcgtcgtacgcctacgacttggcctcgtcgtag

DBGET integrated database retrieval system